KEGG   Deferribacter desulfuricans: DEFDS_1030Help
Entry
DEFDS_1030        CDS       T01188                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ddf  Deferribacter desulfuricans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DEFDS_1030 (folP)
Enzymes [BR:ddf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DEFDS_1030 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030030..1031223
Genome map
AA seq 397 aa AA seqDB search
MFKIFEVKPDKNRLIFELKKIGVDDYALSLHEKGEILCLKILNLTPGQANILKQEALAVG
ADVAVAKGAVTCKIEKTDALLLITKKSIRNLIRKLKLQPFNLDKLAIELEQLLKQKETSY
FVAKDVRLPLDKPYIVGILNVTPDSFSDGGKYLGEKSIDARLDYFLENEIKIVDIGGEST
RPGAEPVSAKNEIKRIAYAIKRSLEKGFVVSVDTYKSVVAEFALKEGVHIINDISGFNFD
NNMAEVCARYGCGVCLMHIKGTPKNMQDNPTYNNLLEDIKLYLKKSIDIALKCGVSKNSI
MLDPGFGFGKTLDDNYLILKYLEEIKTLGYPLFIGVSRKSMIGKIIDKTPEERDVPSKAI
EFLAMIKGANFIRTHEVKYAKDIAKIAEYYSKVELNA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatatttgaagtaaaaccagataaaaatagattaatctttgaattaaaaaag
ataggtgttgatgattatgccttgtctttacatgaaaaaggtgaaattttatgtttaaaa
atattaaatctaactcctggacaagcaaatattttaaaacaggaggctttagcagtaggt
gccgatgtagctgtagcaaaaggtgcagttacttgtaaaattgaaaagacagatgcgtta
ctgttaattacaaaaaaaagtattagaaatctgataagaaaattaaaacttcaacctttt
aatcttgataaattagcaattgaactggagcaattgttaaagcagaaagagacctcttat
tttgtagctaaagatgttagattgcctttggataaaccatatattgttgggatattaaat
gtcacaccagattcatttagtgatggtggtaagtatttgggtgaaaagagtattgatgct
aggttagactattttttagaaaatgaaattaaaattgtggatataggtggagaatctaca
agacctggagcagaacctgtttcggcaaaaaatgaaataaaaaggattgcttatgctatt
aaacgttcactagaaaaaggttttgtagtatcggtggatacttataaatctgtagttgca
gagtttgccttaaaggaaggtgttcatattataaatgatattagtggatttaattttgat
aacaatatggctgaggtatgtgccagatacgggtgtggtgtgtgtttgatgcatattaaa
ggaactcctaagaatatgcaggataacccaacttataataatttattggaagatattaaa
ctttatttgaaaaaatctatagatattgctttaaaatgtggggtttctaaaaatagtata
atgctggatccaggttttggttttggaaaaactttggatgataattatttaattttgaaa
tatttagaagagattaaaactttaggttacccattgtttattggtgtttcaagaaaatct
atgattggcaaaattatagataaaacgccagaagaaagggatgtgccaagtaaagcaata
gaatttttggcaatgattaaaggtgctaattttattagaactcatgaagtaaagtatgct
aaagatatagctaagatagcagaatattatagcaaggttgagttaaatgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system