KEGG   Deferribacter desulfuricans SSM1: DEFDS_1030Help
Entry
DEFDS_1030        CDS       T01188                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030030..1031223
Genome map
AA seq 397 aa AA seqDB search
MFKIFEVKPDKNRLIFELKKIGVDDYALSLHEKGEILCLKILNLTPGQANILKQEALAVG
ADVAVAKGAVTCKIEKTDALLLITKKSIRNLIRKLKLQPFNLDKLAIELEQLLKQKETSY
FVAKDVRLPLDKPYIVGILNVTPDSFSDGGKYLGEKSIDARLDYFLENEIKIVDIGGEST
RPGAEPVSAKNEIKRIAYAIKRSLEKGFVVSVDTYKSVVAEFALKEGVHIINDISGFNFD
NNMAEVCARYGCGVCLMHIKGTPKNMQDNPTYNNLLEDIKLYLKKSIDIALKCGVSKNSI
MLDPGFGFGKTLDDNYLILKYLEEIKTLGYPLFIGVSRKSMIGKIIDKTPEERDVPSKAI
EFLAMIKGANFIRTHEVKYAKDIAKIAEYYSKVELNA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatatttgaagtaaaaccagataaaaatagattaatctttgaattaaaaaag
ataggtgttgatgattatgccttgtctttacatgaaaaaggtgaaattttatgtttaaaa
atattaaatctaactcctggacaagcaaatattttaaaacaggaggctttagcagtaggt
gccgatgtagctgtagcaaaaggtgcagttacttgtaaaattgaaaagacagatgcgtta
ctgttaattacaaaaaaaagtattagaaatctgataagaaaattaaaacttcaacctttt
aatcttgataaattagcaattgaactggagcaattgttaaagcagaaagagacctcttat
tttgtagctaaagatgttagattgcctttggataaaccatatattgttgggatattaaat
gtcacaccagattcatttagtgatggtggtaagtatttgggtgaaaagagtattgatgct
aggttagactattttttagaaaatgaaattaaaattgtggatataggtggagaatctaca
agacctggagcagaacctgtttcggcaaaaaatgaaataaaaaggattgcttatgctatt
aaacgttcactagaaaaaggttttgtagtatcggtggatacttataaatctgtagttgca
gagtttgccttaaaggaaggtgttcatattataaatgatattagtggatttaattttgat
aacaatatggctgaggtatgtgccagatacgggtgtggtgtgtgtttgatgcatattaaa
ggaactcctaagaatatgcaggataacccaacttataataatttattggaagatattaaa
ctttatttgaaaaaatctatagatattgctttaaaatgtggggtttctaaaaatagtata
atgctggatccaggttttggttttggaaaaactttggatgataattatttaattttgaaa
tatttagaagagattaaaactttaggttacccattgtttattggtgtttcaagaaaatct
atgattggcaaaattatagataaaacgccagaagaaagggatgtgccaagtaaagcaata
gaatttttggcaatgattaaaggtgctaattttattagaactcatgaagtaaagtatgct
aaagatatagctaagatagcagaatattatagcaaggttgagttaaatgcttga

DBGET integrated database retrieval system