KEGG   Deferribacter desulfuricans: DEFDS_1071Help
Entry
DEFDS_1071        CDS       T01188                                 

Gene name
glnS
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ddf  Deferribacter desulfuricans
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    DEFDS_1071 (glnS)
Enzymes [BR:ddf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     DEFDS_1071 (glnS)
Amino acid related enzymes [BR:ddf01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DEFDS_1071 (glnS)
Transfer RNA biogenesis [BR:ddf03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DEFDS_1071 (glnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065826..1067277
Genome map
AA seq 483 aa AA seqDB search
MSVRVRFAPSPTGHIHVGNVRTALFNYLFAKHNNGKFILRIEDTDLERSTKESENLIYED
LQWLGLDWDEGPIKGGDYGPYRQTERFDIYKKYVDKLLEEGKAYKCFCSKEELEEKKERA
LKEGKPPRYNGKCRNLNENQIEELEKKGVKPSIRFKVEDEDVVVNDLIKGEITFNTDAFG
DFIIVRPDGTPVYNFVVVIDDALMKITHVIRGDDHLSNTPKQVLIYKALGFDIPYFAHIP
MILGPDHSKLSKRHGDTSVNQFREKGYLPEALFNYLALLSWSHPEEKEILSKDELIKSFT
LDRVSKSAAVFDFEKLKWINGIYIRNKDIKELTKLCIPFLLKSGLIDEDFINTSFNRLAN
MVESIRDNLEVLSDVTKYIGVYFKMETDFDDATKEILSYETTKPVLETFKKNIENLEILD
VDNYKSIIKAVQKETGAKGKKLFMAIRVGVSGKIKGPELDKLVINLGKNEVINRINKILD
MLS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaagagttagatttgctccgagtccaacagggcatatacatgttggcaacgta
agaacggcattatttaattatctttttgcaaaacacaataatgggaaatttatacttagg
atagaagatactgatttggaaagatctacaaaggagagtgaaaatttgatatatgaagat
cttcaatggcttggtttagattgggatgaaggacctataaagggtggagattatggacca
tatagacagactgaaagatttgatatttacaaaaagtatgtagataagcttttagaagaa
gggaaagcttacaagtgtttttgtagtaaagaagagcttgaagagaagaaagaaagagca
ttgaaagaggggaaaccacctagatataatggcaaatgcaggaatttaaacgaaaaccag
atagaagaattggagaaaaaaggggtaaaaccttctataagatttaaagttgaagatgag
gatgttgttgttaatgatttgataaaaggggaaataacttttaatacagatgcatttggg
gattttattattgtaagaccagatggaacccctgtttataactttgttgttgttatagat
gatgctttaatgaaaataacacacgttataagaggggatgaccatttaagtaatacacca
aaacaagtacttatttataaagctttaggctttgatatcccttattttgcacatatccca
atgattttagggcctgatcattcaaaattaagcaaaagacatggggatacaagtgtaaat
caatttagagaaaaaggctatttaccagaggcgttgtttaattatttagctttactttca
tggtctcatcctgaagagaaggaaattttatcaaaagatgaattgataaagagctttact
cttgatagggtatcaaaaagtgcagcggtttttgattttgaaaagcttaaatggataaac
ggtatttatattagaaataaggatattaaagagcttacaaaattgtgtattccatttctg
ttaaaatcaggattgatagatgaagattttattaatacatcttttaataggcttgcaaat
atggtcgagtctatacgtgataacctggaagttttatcagatgtaacaaaatatattgga
gtatattttaaaatggaaactgattttgatgatgccacaaaagaaattttatcttatgaa
acaacaaaacctgttttagaaacatttaagaaaaatattgagaatttggaaattttggat
gtagataattataaatctatcataaaagcggttcaaaaagaaactggagctaaaggtaaa
aaactttttatggcaattagagtaggagtttctggaaaaataaaaggtccagagcttgat
aaacttgttattaatcttggaaaaaatgaagtaataaatagaattaataaaatattggat
atgttaagttag

  All links  
No link information was found.   
DBGET integrated database retrieval system