KEGG   Deferribacter desulfuricans SSM1: DEFDS_1071Help
Entry
DEFDS_1071        CDS       T01188                                 

Gene name
glnS
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ddf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065826..1067277
Genome map
AA seq 483 aa AA seqDB search
MSVRVRFAPSPTGHIHVGNVRTALFNYLFAKHNNGKFILRIEDTDLERSTKESENLIYED
LQWLGLDWDEGPIKGGDYGPYRQTERFDIYKKYVDKLLEEGKAYKCFCSKEELEEKKERA
LKEGKPPRYNGKCRNLNENQIEELEKKGVKPSIRFKVEDEDVVVNDLIKGEITFNTDAFG
DFIIVRPDGTPVYNFVVVIDDALMKITHVIRGDDHLSNTPKQVLIYKALGFDIPYFAHIP
MILGPDHSKLSKRHGDTSVNQFREKGYLPEALFNYLALLSWSHPEEKEILSKDELIKSFT
LDRVSKSAAVFDFEKLKWINGIYIRNKDIKELTKLCIPFLLKSGLIDEDFINTSFNRLAN
MVESIRDNLEVLSDVTKYIGVYFKMETDFDDATKEILSYETTKPVLETFKKNIENLEILD
VDNYKSIIKAVQKETGAKGKKLFMAIRVGVSGKIKGPELDKLVINLGKNEVINRINKILD
MLS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaagagttagatttgctccgagtccaacagggcatatacatgttggcaacgta
agaacggcattatttaattatctttttgcaaaacacaataatgggaaatttatacttagg
atagaagatactgatttggaaagatctacaaaggagagtgaaaatttgatatatgaagat
cttcaatggcttggtttagattgggatgaaggacctataaagggtggagattatggacca
tatagacagactgaaagatttgatatttacaaaaagtatgtagataagcttttagaagaa
gggaaagcttacaagtgtttttgtagtaaagaagagcttgaagagaagaaagaaagagca
ttgaaagaggggaaaccacctagatataatggcaaatgcaggaatttaaacgaaaaccag
atagaagaattggagaaaaaaggggtaaaaccttctataagatttaaagttgaagatgag
gatgttgttgttaatgatttgataaaaggggaaataacttttaatacagatgcatttggg
gattttattattgtaagaccagatggaacccctgtttataactttgttgttgttatagat
gatgctttaatgaaaataacacacgttataagaggggatgaccatttaagtaatacacca
aaacaagtacttatttataaagctttaggctttgatatcccttattttgcacatatccca
atgattttagggcctgatcattcaaaattaagcaaaagacatggggatacaagtgtaaat
caatttagagaaaaaggctatttaccagaggcgttgtttaattatttagctttactttca
tggtctcatcctgaagagaaggaaattttatcaaaagatgaattgataaagagctttact
cttgatagggtatcaaaaagtgcagcggtttttgattttgaaaagcttaaatggataaac
ggtatttatattagaaataaggatattaaagagcttacaaaattgtgtattccatttctg
ttaaaatcaggattgatagatgaagattttattaatacatcttttaataggcttgcaaat
atggtcgagtctatacgtgataacctggaagttttatcagatgtaacaaaatatattgga
gtatattttaaaatggaaactgattttgatgatgccacaaaagaaattttatcttatgaa
acaacaaaacctgttttagaaacatttaagaaaaatattgagaatttggaaattttggat
gtagataattataaatctatcataaaagcggttcaaaaagaaactggagctaaaggtaaa
aaactttttatggcaattagagtaggagtttctggaaaaataaaaggtccagagcttgat
aaacttgttattaatcttggaaaaaatgaagtaataaatagaattaataaaatattggat
atgttaagttag

DBGET integrated database retrieval system