KEGG   Deferribacter desulfuricans: DEFDS_1198Help
Entry
DEFDS_1198        CDS       T01188                                 

Definition
chemotaxis-specific methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ddf  Deferribacter desulfuricans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DEFDS_1198
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DEFDS_1198
Enzymes [BR:ddf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DEFDS_1198
Two-component system [BR:ddf02022]
 CheA family
  CheA-CheYBV
   DEFDS_1198
Bacterial motility proteins [BR:ddf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DEFDS_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200964..1202022
Genome map
AA seq 352 aa AA seqDB search
MSKIKVLVVDDSALMRKRIKEMLESDPKIEVIGLARNGEDAIKKAKELSPDVITLDVNMP
VMDGLTALKLIVEEEICPVIMVSSLTQKDAEITFKALELGAFDFVPKPGGTISLNIDQIR
DDLIRKVKAAVKGKFKTLKRSVDRKKTIKRRITRRKENESGFKAICIGISTGGPKTIFDV
LPYLPKDINAAIFLVQHMPPGFTASFAKRLDNYCEIKVKEAEAGDIVEPGICYLGKGGYH
LTLFQRLNKDIILRLPTKPEHLFMPSVDVMMDSVVKIFQSNTIGVLMTGMGDDGAEGMVK
IKNAGGYTIAESEETAVVFGMPAEAIKRGGADIVLPSYEIANEILRVLEEGW
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaataaaagtattggttgttgatgattctgctttaatgagaaaaagaattaag
gaaatgcttgagagtgatccaaaaatagaggttatagggttagcaagaaatggtgaagat
gcaataaaaaaggcgaaagaattatctcctgatgtaattacattagatgttaatatgcct
gtaatggacggactgacagctttaaaattgattgttgaagaagaaatatgtcctgtaatt
atggttagttctttgactcagaaagatgctgaaatcacttttaaggctttagaacttgga
gcttttgactttgtaccaaagccaggggggactatatctttaaacattgatcagattaga
gatgatttaattagaaaagttaaagcagctgttaaaggaaagtttaaaacgttaaaacgt
tctgttgatagaaaaaaaactataaaaagaagaattacaagaagaaaagaaaacgaatct
ggttttaaagcaatttgtataggtatatctactggagggccaaaaacaattttcgatgtt
ttaccatatttgcctaaagatataaatgcagctatttttttagtgcagcatatgcctcca
ggatttactgcatcttttgctaaaagacttgataattattgtgagataaaagttaaagaa
gctgaggcaggagatattgttgagccaggaatttgctatttaggtaagggaggctaccac
ttaactctttttcaaaggcttaataaagatataattttaaggttgccaacgaaaccagaa
cacctttttatgccgagtgtagatgtgatgatggattcagttgttaaaatttttcaatct
aatactattggcgttttaatgactgggatgggggatgatggagctgaagggatggtaaaa
ataaaaaatgctggaggatatacaatagcagaaagtgaagaaacagctgtggtttttgga
atgcctgcagaagcaattaaaaggggaggagctgatattgtattaccaagttatgaaatt
gctaatgagattttgagagtattggaagaaggatggtaa

DBGET integrated database retrieval system