KEGG   Deferribacter desulfuricans: DEFDS_1230Help
Entry
DEFDS_1230        CDS       T01188                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DEFDS_1230
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DEFDS_1230
Exosome [BR:ddf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEFDS_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241433..1242923)
Genome map
AA seq 496 aa AA seqDB search
MSKYIVALDSGTTGNKAIAFDLQGNIAAYSYTEFPQIFPKSGWVEQNPYDILNSALKVLK
DVIEKVGVENVLALGITNQRETTILWDKETGEPLYNAIVWQCRRSAEICERLSDNKNMIK
DKTGLFLDPYFSATKVIWLNENIEKVRNLISKGNVLLGTVDSWLLYNLTSDKLHLTDITN
ASRTMFFNINTLDYDRDLLKLFEIPDYILPEVKPSGANFGVIDKKYFGKEIPITAVIGDQ
QSALFAHGGWREGLIKNTYGTGLFLMTSTKNNIFKSNNLISTVAWQIEDDVEYALEGSVF
IGGSLVQWLRDNLNLIEKSPDIEHIAANVENSNGVYIVPAFSGIGAPYWDHSARGVIIGI
TRGTTKEHIARAALEAIAFQVKDIFEELRKDTKIEFKTLSVDGGASENRLLLQIQADMLG
LSVEKTTVKESTAFGAAALAGIVAGVWDKSDILKIREIEYIFNPDKDYHYYQKSYKVWKE
AVKRSLGWGSFINTLE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtatattgtagctttagattctgggactactggcaataaagctatagctttt
gacttgcaaggtaatattgcagcttattcttatacagagtttcctcaaatatttccaaaa
agtggatgggtggagcaaaatccctatgatatattaaacagtgccttaaaagttttaaaa
gatgttattgaaaaagtaggtgttgaaaatgtattagcgttggggataacaaatcaaagg
gaaacgacaatattatgggataaagaaactggagaacctctttacaacgcgatcgtttgg
caatgcagaagatcagctgaaatttgtgaaagattatcagataacaaaaatatgataaaa
gataaaacagggctttttttagatccatattttagtgctacaaaggtgatttggttaaat
gaaaatatagaaaaggttagaaacttgatttcaaaaggaaatgttttattaggtacagtt
gatagttggttactttataatcttacgtcagacaaattgcacttaacagatattacaaat
gcttctaggactatgttttttaatataaatacattagactatgatagagatttattaaaa
ttatttgagattccagattatattttacctgaggttaagccatctggtgccaattttggc
gtaattgataagaaatattttggaaaagagataccaattactgcagtaataggcgatcag
caatcggcactatttgctcatggaggatggagagaaggtcttatcaaaaatacctatgga
actggtttgtttttaatgacatctacgaaaaataatattttcaaaagtaacaatctgata
tctactgtagcatggcaaatagaagatgatgttgaatatgctttagaaggtagtgttttt
attggtggttcgcttgtacagtggctaagagataatttaaaccttattgaaaaaagtcct
gatattgagcatattgctgctaatgtagaaaattcaaatggagtttatattgttcctgct
ttcagtggtattggagctccttactgggatcattctgctaggggagtaatcattggaatt
actagaggaacaacgaaagagcatatagcaagggcagctcttgaagcaattgcatttcag
gtaaaagatatatttgaggaattaagaaaagatacaaaaatagagtttaaaacactttct
gtagatggtggagcatcagaaaacagattattattgcaaattcaggctgatatgctgggg
ttatctgtggaaaaaacaacagttaaagaatccacagcatttggtgctgcagctttggca
ggcattgtcgccggagtttgggataaaagtgatattttgaaaattagagaaattgaatat
atttttaatccagataaagattatcattattatcaaaaaagttataaagtgtggaaggaa
gcagtaaaaaggtctttaggttggggtagctttatcaacactttggagtag

DBGET integrated database retrieval system