KEGG   Deferribacter desulfuricans: DEFDS_1284Help
Entry
DEFDS_1284        CDS       T01188                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ddf  Deferribacter desulfuricans
Brite
Enzymes [BR:ddf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     DEFDS_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295181..1296095)
Genome map
AA seq 304 aa AA seqDB search
MIVIKWFIIPWVVFVLVLTAYMFFYKEKLTELKPFPDLSLINTNELLEMDVKRAISEGVN
KKENMPHYYKGGSEIGFLLIHGFTASPYEMSFLAKYLNSKGYYVYNARVAGHGSSPENLN
VLTYEDWYESLKYGYFVLKKNCKKIFVVGQSMGGLLAYNLSVLNDVDGAVLLSPALGIKS
IKFSFMPILKNFVNFVEKEDFDTKYQDYYYRVRPVKGLYQLYLLIDYTWSMINKKSFPVY
IIYSAYDDIINNKEVERFYNKLQVSKKKIDLIKQKDIKHILTLNDNPEAAEDIFKKIEKW
VRED
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaattaaatggtttataattccttgggttgtatttgttttagtgctcacagcg
tatatgtttttttataaagaaaaactcaccgaattgaagccatttcccgatttaagtttg
ataaatactaatgagctattggaaatggatgttaaaagagcaatttctgagggtgtgaat
aaaaaagagaatatgcctcattattataaagggggtagtgaaatcggttttttacttata
catggttttaccgcatctccttatgaaatgagttttttagcaaagtatttaaattctaaa
ggttattatgtttataatgctagggttgctggtcatggtagtagtccagaaaatttaaac
gttttaacttatgaagattggtatgaatctttaaaatacggttactttgttttaaagaaa
aattgtaaaaaaatttttgttgttggtcaatcaatgggggggcttcttgcgtataactta
tctgttttaaatgatgtggatggggcagtattgttgtctccagctttaggaattaagagt
ataaagtttagttttatgcccatattgaaaaattttgttaattttgtagaaaaagaggat
tttgatacaaaatatcaggattattattatagagttcgtccagtaaaaggtttgtatcaa
ttatatttgttgattgattatacatggagtatgattaataaaaaatcatttcctgtctac
ataatttattcagcttatgatgatataataaataataaagaagtggaaagattttataac
aagcttcaagttagcaaaaaaaagattgatttaataaaacaaaaagatataaaacatata
ttaacgctgaatgataatccagaagcagcggaagatatatttaaaaaaattgaaaagtgg
gttagggaggattaa

DBGET integrated database retrieval system