KEGG   Deferribacter desulfuricans: DEFDS_1337Help
Entry
DEFDS_1337        CDS       T01188                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEFDS_1337 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_1337 (glcK)
   00052 Galactose metabolism
    DEFDS_1337 (glcK)
   00500 Starch and sucrose metabolism
    DEFDS_1337 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    DEFDS_1337 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DEFDS_1337 (glcK)
   00524 Butirosin and neomycin biosynthesis
    DEFDS_1337 (glcK)
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DEFDS_1337 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1347060..1347926)
Genome map
AA seq 288 aa AA seqDB search
MNVYVFDIGGTNIKYAYFNNETIEFKDTVKTPSSYDELLSLIKHKIQKPYDKVVIGLPAI
LDYEKNCPIYAPNLTYLTNKNVVSHLNIKNVYLENDANLAAFGEYKKCHHDVKNMLMVTL
GTGVGGGLILNGRIVKSKYSLAEIGHIVVVDNGWKCSCGNRGCLEAYCGKNGIMNIYKSL
SNNKEEIDSVNRIYQLAIQKKLIAKLTFKQFAHYLAIGVASFVNSIYVEKVVLGGGVSHY
SDMFFKDFIKFFNEKLYPPYKKDVIIHLSRLKNDAALYGGYFYAKDIL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttatgtttttgatataggtgggacaaatattaagtatgcctactttaataat
gaaacgatagaatttaaagatactgttaaaacgccaagtagttatgatgaattattgagt
ttgataaagcataaaattcaaaagccttacgacaaagtggtaattggcctaccagctatc
ttagattatgagaaaaattgcccaatttatgctccaaatttaacttatttgacaaacaaa
aatgttgtcagccatttgaatataaaaaatgtttatttggaaaatgatgccaatttagca
gcctttggagaatataaaaaatgccatcatgatgtaaaaaatatgttaatggttactttg
ggaacaggtgtgggtggtggtttaatattaaatggtagaattgtaaaatcaaagtattct
ttagctgaaattggtcatattgtagtagttgataatggttggaaatgttcttgtggtaat
agaggctgtttagaagcttattgcggtaaaaatggtataatgaatatttataaatcttta
tcaaataataaagaagagattgattctgttaataggatatatcagttggcaattcaaaaa
aagttaatagcaaaattgacttttaaacagtttgcgcattatttggccattggtgtggct
tcatttgtaaactctatatatgtggaaaaggtagttttgggtggtggcgtttcacattat
tctgatatgttttttaaagattttattaaattttttaatgaaaaattgtatcctccatac
aaaaaagatgttataatacatttatcaagattaaaaaatgatgctgctctgtatggaggt
tacttttatgcgaaggatattttatag

DBGET integrated database retrieval system