KEGG   Deferribacter desulfuricans SSM1: DEFDS_1383Help
Entry
DEFDS_1383        CDS       T01188                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddf01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ddf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393600..1394742)
Genome map
AA seq 380 aa AA seqDB search
MRKLPDIKTLVIKIGSNLLTNNSRYIDKEYIRTLAKTIHKIKKDIKNILIVSSGAIAAGM
QQLGIGTKPKDIALRQACAAIGQPKLIQIYEDAFDEYNIKVAQILITKDDFANRRRYLNA
KYTIRELFKHSVVPIVNENDTVVVEELKFVDSFGDNDNLSALIAGLIGAELLLILSDVDG
FFSKDPTKHKDAVLINEIKYFDSKLLSMAGDSISNVGTGGMKSKILAAKKALNAGCYVGI
INGKDPDNIVKFLNGEEIGTFFSHLEDPLKKRKLWIAYATIPKGEIVVDNGARNALINKY
TSLLPSGIVDVKGRFSVGDIVKIVDINGIELGRGKVRYNHQEIEKIKGKKTTEIMKILGY
KFSDEVIHRDDFVLSDFLEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattacccgacattaaaaccttagtcataaaaatcggaagtaacctcttaaca
aacaacagtagatatatcgataaagaatatattagaactttagccaaaactattcataaa
atcaaaaaagatattaaaaatattttaatagtaagttctggagcaatagctgctgggatg
cagcagttgggtattggaacgaaaccgaaagatatagctttaaggcaagcctgtgccgct
attggccaaccaaagcttattcaaatttatgaagatgcctttgatgagtataatataaaa
gtagcacaaattttgataacgaaagatgattttgccaatagaagaagatatctaaatgct
aaatacaccataagagagttatttaagcactctgtggtgccaatcgttaatgaaaatgac
actgtagtagttgaagagctgaaatttgttgatagttttggcgataatgataatctttct
gctctgatagcagggcttattggagcagagttgttgttgattttatcagatgttgatgga
tttttttcaaaagatcctacaaaacacaaagatgctgtcttaattaacgaaattaaatat
tttgatagtaaactgttgagcatggctggagattcaatttcaaatgttggtactggtgga
atgaagtccaaaatattagctgcaaagaaggcacttaatgcaggttgttatgtggggata
ataaatggtaaggatcctgataatattgttaagtttttaaatggtgaagaaattgggaca
tttttctcgcatcttgaagatcctttgaaaaaaaggaagttatggattgcatatgccaca
atccctaaaggggaaattgtggttgataatggagctagaaatgctttaattaataaatac
acatccttgctaccaagtggtattgttgatgttaaaggtcgatttagtgttggagatatt
gtgaaaattgttgatattaatgggattgagttaggacgtggtaaggttcgttataatcat
caggaaattgaaaagattaagggtaaaaagactacagaaattatgaaaattttaggatat
aaatttagtgatgaggtaatacatagagatgattttgttttatcagattttttggagggg
taa

DBGET integrated database retrieval system