KEGG   Deferribacter desulfuricans: DEFDS_1396Help
Entry
DEFDS_1396        CDS       T01188                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00260  Glycine, serine and threonine metabolism
ddf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01130  Biosynthesis of antibiotics
ddf01230  Biosynthesis of amino acids
Module
ddf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEFDS_1396
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEFDS_1396
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEFDS_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI80857
UniProt: D3PE34
Position
complement(1410824..1412170)
Genome map
AA seq 448 aa AA seqDB search
MKRVYLKTNEMPKQWYNILADLPTPMDPPLSPFTKKTVTFDEMKAIFPESLIEQEMSDKR
WIDIPEEVLEILSLWRPTPLIRAERLEEYLGTPAKIYFKYEGVSPAGSHKPNTAVAQAYY
NKKEGVQRLTTETGAGQWGSALAFATKMFNMECRVYMVKVSFYQKPYRKSFMRMFGAEVI
PSPSEFTNSGRAILEKNPDSNGSLGIAISEAVEEAAGRNDTNYALGSVLNHVLLHQTVIG
LEAKKQFEIVGDYPDMIFASCGGGSNFGGIAFPFLADKFSGKNVDAVAVEPASCPTLTKG
KYAYDYGDVAKLTPIMPMFTLGHDFEPPAIHAGGLRYHGDSPIVSKLYKDGLISATAVKQ
LEVFQYGTLFAQLEGIVPAPESAHAIAATIKEAIKCKETGEEKTLLFCLSGHGFFDMASY
DAYFDGKLEDYEYPEDLIEESLKNLPEV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggtatatttaaaaactaatgagatgccaaaacagtggtataatatattggct
gatttgcctacaccaatggatccacctctaagcccttttaccaaaaaaactgtaactttt
gatgaaatgaaagctattttccctgaaagtttgattgaacaggagatgagcgataaaagg
tggatagatatccctgaagaggttttagaaattttatcgttatggagacctacaccatta
ataagagcagaaaggttagaagagtatttggggacaccagcaaaaatttattttaaatac
gaaggtgtttcacctgcaggaagccataaacctaacacagctgtggctcaggcttattac
aataaaaaagagggagttcaaaggcttactacagaaactggagcagggcagtggggtagc
gctttagcctttgcaaccaaaatgtttaatatggaatgtagagtttatatggtgaaagta
agcttctatcaaaaaccttatagaaaatcttttatgagaatgtttggagctgaagtaatt
ccaagcccttctgaatttacaaatagtggtagagcaattttggaaaaaaatcctgactct
aatggtagtttgggtattgcaattagtgaggcagtagaggaagctgcaggtagaaacgat
acaaattatgctttgggtagtgttttaaatcatgttttgttgcatcagactgtgattggt
ttagaagcgaaaaagcagtttgaaatcgtaggtgattatcctgatatgatatttgcatcc
tgtggtggtgggtcaaattttggtggaatagcttttccatttttggcagataaatttagt
ggtaaaaatgtggatgctgtggctgtggagccagcaagctgtccaacattgacaaaaggt
aaatatgcctatgattatggtgatgtggcaaaattgacacctatcatgcctatgtttact
ttgggtcatgattttgaaccgcctgcaattcatgctggtgggttgagatatcatggagat
tctccgattgtaagtaagctttataaagatggcttgatttctgctactgcagtaaaacag
cttgaagtttttcaatatgggacactttttgcccaattagaagggatagttcccgctcct
gaatcagctcatgcgatcgcagcgactataaaggaagctataaagtgtaaagagactggg
gaagaaaaaacgttgctattttgcctcagcggacatggatttttcgatatggcatcttat
gatgcttattttgatggtaaacttgaagattacgaataccctgaagatttgatagaagaa
tctttgaagaatttaccggaagtataa

DBGET integrated database retrieval system