KEGG   Deferribacter desulfuricans: DEFDS_1396Help
Entry
DEFDS_1396        CDS       T01188                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEFDS_1396
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEFDS_1396
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEFDS_1396
Enzymes [BR:ddf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEFDS_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1410824..1412170)
Genome map
AA seq 448 aa AA seqDB search
MKRVYLKTNEMPKQWYNILADLPTPMDPPLSPFTKKTVTFDEMKAIFPESLIEQEMSDKR
WIDIPEEVLEILSLWRPTPLIRAERLEEYLGTPAKIYFKYEGVSPAGSHKPNTAVAQAYY
NKKEGVQRLTTETGAGQWGSALAFATKMFNMECRVYMVKVSFYQKPYRKSFMRMFGAEVI
PSPSEFTNSGRAILEKNPDSNGSLGIAISEAVEEAAGRNDTNYALGSVLNHVLLHQTVIG
LEAKKQFEIVGDYPDMIFASCGGGSNFGGIAFPFLADKFSGKNVDAVAVEPASCPTLTKG
KYAYDYGDVAKLTPIMPMFTLGHDFEPPAIHAGGLRYHGDSPIVSKLYKDGLISATAVKQ
LEVFQYGTLFAQLEGIVPAPESAHAIAATIKEAIKCKETGEEKTLLFCLSGHGFFDMASY
DAYFDGKLEDYEYPEDLIEESLKNLPEV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggtatatttaaaaactaatgagatgccaaaacagtggtataatatattggct
gatttgcctacaccaatggatccacctctaagcccttttaccaaaaaaactgtaactttt
gatgaaatgaaagctattttccctgaaagtttgattgaacaggagatgagcgataaaagg
tggatagatatccctgaagaggttttagaaattttatcgttatggagacctacaccatta
ataagagcagaaaggttagaagagtatttggggacaccagcaaaaatttattttaaatac
gaaggtgtttcacctgcaggaagccataaacctaacacagctgtggctcaggcttattac
aataaaaaagagggagttcaaaggcttactacagaaactggagcagggcagtggggtagc
gctttagcctttgcaaccaaaatgtttaatatggaatgtagagtttatatggtgaaagta
agcttctatcaaaaaccttatagaaaatcttttatgagaatgtttggagctgaagtaatt
ccaagcccttctgaatttacaaatagtggtagagcaattttggaaaaaaatcctgactct
aatggtagtttgggtattgcaattagtgaggcagtagaggaagctgcaggtagaaacgat
acaaattatgctttgggtagtgttttaaatcatgttttgttgcatcagactgtgattggt
ttagaagcgaaaaagcagtttgaaatcgtaggtgattatcctgatatgatatttgcatcc
tgtggtggtgggtcaaattttggtggaatagcttttccatttttggcagataaatttagt
ggtaaaaatgtggatgctgtggctgtggagccagcaagctgtccaacattgacaaaaggt
aaatatgcctatgattatggtgatgtggcaaaattgacacctatcatgcctatgtttact
ttgggtcatgattttgaaccgcctgcaattcatgctggtgggttgagatatcatggagat
tctccgattgtaagtaagctttataaagatggcttgatttctgctactgcagtaaaacag
cttgaagtttttcaatatgggacactttttgcccaattagaagggatagttcccgctcct
gaatcagctcatgcgatcgcagcgactataaaggaagctataaagtgtaaagagactggg
gaagaaaaaacgttgctattttgcctcagcggacatggatttttcgatatggcatcttat
gatgcttattttgatggtaaacttgaagattacgaataccctgaagatttgatagaagaa
tctttgaagaatttaccggaagtataa

DBGET integrated database retrieval system