KEGG   Deferribacter desulfuricans: DEFDS_1511Help
Entry
DEFDS_1511        CDS       T01188                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ddf  Deferribacter desulfuricans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DEFDS_1511
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     DEFDS_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1533887..1534384)
Genome map
AA seq 165 aa AA seqDB search
MVKVILGLGSNLGDRVQNIYSALKSLEKNMIFIKRISPIYSTKSLLRDNQPDYLNLVAVS
FTNLQPENILFIVKKIEDQMGRKKIGKWKERIIDIDIIDYNGEIIKSGNLKVPHPEFTKR
SFVLYPMLDIERDYLHPEYEKGLTYFIKNLEDDLGIKKVGELKWL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggtcattttaggtttaggctcgaatttaggggatagagtacaaaatatttat
agtgctttaaagtcccttgaaaaaaatatgatttttataaagaggatatctccaatatac
tcaacaaaatctcttttaagggacaatcaaccagattatttgaatttagtagctgtttct
tttacgaacttacagccagaaaacattttatttattgttaaaaaaattgaagaccaaatg
ggtagaaagaaaataggtaagtggaaagagagaataattgatatcgatataattgattat
aatggagagattataaaatcgggaaatttaaaagtgcctcacccagagtttactaagaga
agctttgtcctttatccaatgctcgatattgaaagagattatttgcatccagaatacgaa
aaagggttaacctattttataaaaaatttagaagatgacttgggtattaaaaaagtgggg
gaactaaaatggctataa

DBGET integrated database retrieval system