KEGG   Deferribacter desulfuricans SSM1: DEFDS_1932Help
Entry
DEFDS_1932        CDS       T01188                                 

Definition
alcohol dehydrogenase zinc-binding (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ddf01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddf00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ddf00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ddf00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ddf00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ddf00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1959971..1960999)
Genome map
AA seq 342 aa AA seqDB search
MKALVIDKLCNVLEEEQPLTLVDLPIPEVGRNEILVEVSACGVCHTELDEIEGRTPPPVL
PVIPGHQIVGRVVRKGEGVTKFDIGDRVGIGWIYSACGECEFCKKGLENLCTNFKATGRD
ANGGYAEYFKIGEDYAVKIPDYFSDYEAAPLLCAGAIGYRSLKLANINNGDRLGLTGFGA
SAHLVLKLVNFLYPDTEVFVFARNPAEREFALSLGAVWAGDTADFSPEKLHAIIDTTPVW
KPIVEGMKNLLPSGRMVINAIRKEDVDKDYLLNIRYEEHLWLEKEIKSVANVTLKDIDEF
INIAADAQIKPEYQLFDLEEANKALKELKNKKIKGAKVLKIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtgatagataagctgtgtaatgtattagaagaggagcaacctttaacg
cttgtagatttaccaataccagaggttgggcgaaatgaaattttagttgaggtttctgca
tgtggtgtatgtcatactgagcttgatgagatagaagggagaactcctcctcctgttttg
cctgttattccaggacatcaaattgtaggaagagttgtacggaaaggggaaggtgttacg
aaatttgatattggggatagagttggtattggatggatttattctgcatgcggtgaatgt
gagttttgtaaaaaggggttggaaaatttatgtaccaattttaaagcaactggtagagat
gcaaatggtggatatgcagaatattttaaaataggtgaagattatgctgttaaaattcct
gattatttcagcgattatgaggctgcacctcttctatgtgctggagcgataggttataga
tcactaaagctagcaaatattaataatggggataggttagggcttacaggttttggagct
tctgcccatctggtactaaaattggtaaattttctttatccagataccgaagtatttgtc
tttgccagaaatccagctgaaagggagtttgccctttctttaggtgcagtttgggctggt
gatacggctgacttttctccagaaaagcttcatgcaattattgatactactccagtctgg
aaacctatagtagaagggatgaaaaatttactcccttctggtagaatggtgataaatgca
attagaaaagaggatgtagataaagattatcttttaaatattcgctatgaagagcatttg
tggcttgaaaaagagataaagtctgttgcgaatgtaacattaaaagatattgatgagttt
ataaatatagctgcagatgcacagattaaacctgaatatcaactttttgaccttgaagaa
gctaataaagcgttaaaggagctcaaaaataaaaagataaagggggcaaaggtattgaaa
ataaaataa

DBGET integrated database retrieval system