KEGG   Deferribacter desulfuricans: DEFDS_1932Help
Entry
DEFDS_1932        CDS       T01188                                 

Definition
alcohol dehydrogenase zinc-binding (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ddf  Deferribacter desulfuricans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DEFDS_1932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_1932
  Lipid metabolism
   00071 Fatty acid degradation
    DEFDS_1932
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEFDS_1932
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DEFDS_1932
   00626 Naphthalene degradation
    DEFDS_1932
Enzymes [BR:ddf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DEFDS_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1959971..1960999)
Genome map
AA seq 342 aa AA seqDB search
MKALVIDKLCNVLEEEQPLTLVDLPIPEVGRNEILVEVSACGVCHTELDEIEGRTPPPVL
PVIPGHQIVGRVVRKGEGVTKFDIGDRVGIGWIYSACGECEFCKKGLENLCTNFKATGRD
ANGGYAEYFKIGEDYAVKIPDYFSDYEAAPLLCAGAIGYRSLKLANINNGDRLGLTGFGA
SAHLVLKLVNFLYPDTEVFVFARNPAEREFALSLGAVWAGDTADFSPEKLHAIIDTTPVW
KPIVEGMKNLLPSGRMVINAIRKEDVDKDYLLNIRYEEHLWLEKEIKSVANVTLKDIDEF
INIAADAQIKPEYQLFDLEEANKALKELKNKKIKGAKVLKIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtgatagataagctgtgtaatgtattagaagaggagcaacctttaacg
cttgtagatttaccaataccagaggttgggcgaaatgaaattttagttgaggtttctgca
tgtggtgtatgtcatactgagcttgatgagatagaagggagaactcctcctcctgttttg
cctgttattccaggacatcaaattgtaggaagagttgtacggaaaggggaaggtgttacg
aaatttgatattggggatagagttggtattggatggatttattctgcatgcggtgaatgt
gagttttgtaaaaaggggttggaaaatttatgtaccaattttaaagcaactggtagagat
gcaaatggtggatatgcagaatattttaaaataggtgaagattatgctgttaaaattcct
gattatttcagcgattatgaggctgcacctcttctatgtgctggagcgataggttataga
tcactaaagctagcaaatattaataatggggataggttagggcttacaggttttggagct
tctgcccatctggtactaaaattggtaaattttctttatccagataccgaagtatttgtc
tttgccagaaatccagctgaaagggagtttgccctttctttaggtgcagtttgggctggt
gatacggctgacttttctccagaaaagcttcatgcaattattgatactactccagtctgg
aaacctatagtagaagggatgaaaaatttactcccttctggtagaatggtgataaatgca
attagaaaagaggatgtagataaagattatcttttaaatattcgctatgaagagcatttg
tggcttgaaaaagagataaagtctgttgcgaatgtaacattaaaagatattgatgagttt
ataaatatagctgcagatgcacagattaaacctgaatatcaactttttgaccttgaagaa
gctaataaagcgttaaaggagctcaaaaataaaaagataaagggggcaaaggtattgaaa
ataaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system