KEGG   Deferribacter desulfuricans: DEFDS_1932Help
Entry
DEFDS_1932        CDS       T01188                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-binding
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00010  Glycolysis / Gluconeogenesis
ddf00071  Fatty acid degradation
ddf00350  Tyrosine metabolism
ddf00625  Chloroalkane and chloroalkene degradation
ddf00626  Naphthalene degradation
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01120  Microbial metabolism in diverse environments
ddf01130  Biosynthesis of antibiotics
ddf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_1932
  Lipid metabolism
   00071 Fatty acid degradation
    DEFDS_1932
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEFDS_1932
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DEFDS_1932
   00626 Naphthalene degradation
    DEFDS_1932
Enzymes [BR:ddf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DEFDS_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N BKACE
Motif
Other DBs
NCBI-ProteinID: BAI81383
UniProt: D3P9J3
Position
complement(1959971..1960999)
Genome map
AA seq 342 aa AA seqDB search
MKALVIDKLCNVLEEEQPLTLVDLPIPEVGRNEILVEVSACGVCHTELDEIEGRTPPPVL
PVIPGHQIVGRVVRKGEGVTKFDIGDRVGIGWIYSACGECEFCKKGLENLCTNFKATGRD
ANGGYAEYFKIGEDYAVKIPDYFSDYEAAPLLCAGAIGYRSLKLANINNGDRLGLTGFGA
SAHLVLKLVNFLYPDTEVFVFARNPAEREFALSLGAVWAGDTADFSPEKLHAIIDTTPVW
KPIVEGMKNLLPSGRMVINAIRKEDVDKDYLLNIRYEEHLWLEKEIKSVANVTLKDIDEF
INIAADAQIKPEYQLFDLEEANKALKELKNKKIKGAKVLKIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtgatagataagctgtgtaatgtattagaagaggagcaacctttaacg
cttgtagatttaccaataccagaggttgggcgaaatgaaattttagttgaggtttctgca
tgtggtgtatgtcatactgagcttgatgagatagaagggagaactcctcctcctgttttg
cctgttattccaggacatcaaattgtaggaagagttgtacggaaaggggaaggtgttacg
aaatttgatattggggatagagttggtattggatggatttattctgcatgcggtgaatgt
gagttttgtaaaaaggggttggaaaatttatgtaccaattttaaagcaactggtagagat
gcaaatggtggatatgcagaatattttaaaataggtgaagattatgctgttaaaattcct
gattatttcagcgattatgaggctgcacctcttctatgtgctggagcgataggttataga
tcactaaagctagcaaatattaataatggggataggttagggcttacaggttttggagct
tctgcccatctggtactaaaattggtaaattttctttatccagataccgaagtatttgtc
tttgccagaaatccagctgaaagggagtttgccctttctttaggtgcagtttgggctggt
gatacggctgacttttctccagaaaagcttcatgcaattattgatactactccagtctgg
aaacctatagtagaagggatgaaaaatttactcccttctggtagaatggtgataaatgca
attagaaaagaggatgtagataaagattatcttttaaatattcgctatgaagagcatttg
tggcttgaaaaagagataaagtctgttgcgaatgtaacattaaaagatattgatgagttt
ataaatatagctgcagatgcacagattaaacctgaatatcaactttttgaccttgaagaa
gctaataaagcgttaaaggagctcaaaaataaaaagataaagggggcaaaggtattgaaa
ataaaataa

DBGET integrated database retrieval system