KEGG   Deferribacter desulfuricans: DEFDS_2074Help
Entry
DEFDS_2074        CDS       T01188                                 

Definition
(GenBank) acetyl-CoA synthetase family protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00010  Glycolysis / Gluconeogenesis
ddf00620  Pyruvate metabolism
ddf00640  Propanoate metabolism
ddf00680  Methane metabolism
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01120  Microbial metabolism in diverse environments
ddf01130  Biosynthesis of antibiotics
ddf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_2074
   00620 Pyruvate metabolism
    DEFDS_2074
   00640 Propanoate metabolism
    DEFDS_2074
  Energy metabolism
   00680 Methane metabolism
    DEFDS_2074
Enzymes [BR:ddf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DEFDS_2074
Lipid biosynthesis proteins [BR:ddf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DEFDS_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAI81523
UniProt: D3P9Y3
Position
complement(2107638..2109284)
Genome map
AA seq 548 aa AA seqDB search
MAHNMENYEETVKNFKIDVPVYYNFGFDVIDKWAEDRSKLALIWVDTDGDTHHKYTFYDL
MKMSNKFANVLRAKGFKKGDKLYVMVPRIPDWYSVMLGCFKMGVIPMPAPKILQPKDIKY
RIDAAEAKGAVVHIDGIEKFEGLELPSLQQKIVVGGKYEDWEDFDGLMSKASDKLSREEV
EPTKSTDPLIIYFTSGTTKFPKMVMHEHSYALAHLITAKFWQDLTPKDLHWTLSDTGWGK
AVWGKMFGQWIIGTTVLMHNAADKFDPEKHLYIMEKYGVTTFCAPPTAYRMLILQDLKKY
DFSQLRHSISAGEPLNPDVIRIWREYTGTTIYDGYGQTETVNTIANFPCLRIKPGSMGKP
TPGFHVDVVDDDGNPVPVGEVGHIAIKVKPEHPIGVFKGYYKNEEATKEAFRGDWYFTGD
KAYKDEDGYFWFVGRADDVIKASGYRIGPFEVESALQSHPAVAESAVVGSPDKIRGTIVK
AFIVLKPGFEPSDELVKDIQEHVKRETAPYKYPREVEFVKELPKTVSGKIRRVELRKMEE
ERKLKNNK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctcataatatggaaaattatgaagaaactgtaaaaaactttaaaattgatgtgcct
gtgtattacaattttggatttgatgtgattgataaatgggcggaggataggagtaaatta
gcacttatttgggttgatacagatggtgatactcaccacaaatatacattttatgacctt
atgaaaatgtccaataaatttgcaaatgttttaagagctaaagggtttaagaaaggggat
aaactttatgtaatggtgccaagaattccagattggtattccgtgatgcttggttgtttt
aagatgggtgtaataccgatgcctgcaccaaagatattacaacctaaagacataaaatac
aggatagatgctgctgaggcaaaaggtgctgtggtacatattgatgggatagaaaaattt
gaagggcttgagttaccttcattgcagcaaaaaattgttgttggtggcaaatatgaggat
tgggaagattttgatggattgatgtcaaaagcatcagataaattaagtagagaagaggtg
gagcctactaagagcactgatccattgataatatattttacaagtggaactacaaaattt
ccaaagatggttatgcatgagcactcatatgctttagcacatcttattaccgctaaattt
tggcaagacttgacaccaaaggatttgcactggactttgagtgatactggctggggtaaa
gcagtatggggtaaaatgtttggtcagtggataataggaacaactgtattaatgcacaat
gcagccgataaatttgatcctgaaaaacatttatatattatggaaaaatatggtgttaca
acattttgtgcaccacctactgcatataggatgcttattttacaagatttaaaaaagtat
gattttagccagctaagacattctattagtgctggagaacctttaaacccagatgtgatt
agaatatggagagagtacacagggacaacgatttacgatggttatggtcagacagaaacg
gtaaatactattgcaaactttccatgtttgagaataaagcctggttcaatggggaaacct
actccaggttttcatgtggatgtagttgatgatgatggtaaccctgtaccagttggagag
gtggggcatatagcaatcaaggtaaaacctgagcacccaataggtgtttttaaagggtat
tataaaaatgaagaggccacaaaagaagcctttagaggtgattggtattttactggtgat
aaggcttataaagatgaagatggctatttctggtttgttggtagagcagatgatgttatt
aaagcaagtggttataggattgggccttttgaagtggaaagtgctttacagtcacatcca
gctgttgcagaaagtgcagttgttggctctccagataagataagaggaactattgttaag
gcttttatagttttaaagccgggttttgagccatctgatgagttagttaaagatattcaa
gaacatgtgaaaagagaaacagcaccttataaatatccaagagaagtagaatttgtgaaa
gagttgcctaagactgtaagcggtaaaattagaagagttgagctcagaaaaatggaagag
gagcgcaaactcaaaaataataaataa

DBGET integrated database retrieval system