KEGG   Desulfitobacterium dehalogenans: Desde_0038Help
Entry
Desde_0038        CDS       T02146                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ddh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33559..34155
Genome map
AA seq 198 aa AA seqDB search
MDFLNYPEPLADLIAGLSRLPGIGPKTAGRLAFYLLQQPQVAENLAETIIKAQQEIKQCS
LCCNYTDHDPCSICTGEKRDASLLCIVEQPRDVVSLEKTREFKGLYHVLHGVISPLEGIG
PEQLTIPKLLGRLEGIKEVVMAMNPTVEGEATAMYLSKLLKPLGIKVTRIAHGLPVGGDL
EYADEITIARALEGRRQI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttttaaattatcctgaaccccttgctgatttgattgcgggtttatcccgctta
cctgggattggacccaaaacggcaggccgcttagctttttatcttctgcagcaaccccaa
gtggccgagaatttagcagaaaccattatcaaggctcagcaagaaatcaagcagtgctct
ctatgctgcaactatacggatcatgacccttgctctatttgtaccggggagaaaagggat
gcttcccttctctgcattgtggagcagccccgggatgtggtttctttagagaaaacaaga
gaatttaaagggctttatcatgtcttgcatggcgttatatcccctttggaagggatcggg
ccggagcagctcacgattcctaagctcttagggcggttggaaggaatcaaggaagtcgtc
atggccatgaacccaacggtagaaggagaagctaccgctatgtacttatccaagctgctt
aagcctttaggaattaaggtgacgcgtatcgcccatggtttaccggtgggcggagatctg
gagtatgccgatgaaattaccattgctcgtgctttagaaggccgtcgccagatataa

DBGET integrated database retrieval system