KEGG   Desulfitobacterium dehalogenans: Desde_0038Help
Entry
Desde_0038        CDS       T02146                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desde_0038
DNA repair and recombination proteins [BR:ddh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desde_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33559..34155
Genome map
AA seq 198 aa AA seqDB search
MDFLNYPEPLADLIAGLSRLPGIGPKTAGRLAFYLLQQPQVAENLAETIIKAQQEIKQCS
LCCNYTDHDPCSICTGEKRDASLLCIVEQPRDVVSLEKTREFKGLYHVLHGVISPLEGIG
PEQLTIPKLLGRLEGIKEVVMAMNPTVEGEATAMYLSKLLKPLGIKVTRIAHGLPVGGDL
EYADEITIARALEGRRQI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttttaaattatcctgaaccccttgctgatttgattgcgggtttatcccgctta
cctgggattggacccaaaacggcaggccgcttagctttttatcttctgcagcaaccccaa
gtggccgagaatttagcagaaaccattatcaaggctcagcaagaaatcaagcagtgctct
ctatgctgcaactatacggatcatgacccttgctctatttgtaccggggagaaaagggat
gcttcccttctctgcattgtggagcagccccgggatgtggtttctttagagaaaacaaga
gaatttaaagggctttatcatgtcttgcatggcgttatatcccctttggaagggatcggg
ccggagcagctcacgattcctaagctcttagggcggttggaaggaatcaaggaagtcgtc
atggccatgaacccaacggtagaaggagaagctaccgctatgtacttatccaagctgctt
aagcctttaggaattaaggtgacgcgtatcgcccatggtttaccggtgggcggagatctg
gagtatgccgatgaaattaccattgctcgtgctttagaaggccgtcgccagatataa

DBGET integrated database retrieval system