KEGG   Desulfitobacterium dehalogenans: Desde_0119Help
Entry
Desde_0119        CDS       T02146                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desde_0119
Enzymes [BR:ddh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Desde_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121737..122960
Genome map
AA seq 407 aa AA seqDB search
MKDYSLRWIDLNNEMEAKKAMQHIGSDPGGIAHMVGKPIGRALKLENVPLPAAHIIKQEM
LSLGGDAAVHRNVIVNKIEATDILLVGTTKHFRRLSQKLAAQPFGLKDLGKSLKSLLEAL
EPPKQRVLSCRGKEIVLGERTLIMGILNLTPDSFSDGGKFNTFEHAIKQAEALVEQGADI
LDIGAESTRLKHDPVSAEEEWNRLEAVIKALLPRLSIPISVDTYKSEVAEKALDAGVHMI
NDIWGLQKDLKMAEVAGKYQAPVIVMHNQEGNSYHHVMGDMMAFLKKSIHLAEEQGLTGD
QIIIDPGIGGTAFGKSLDIDLEIMSRLGEFRSLGHPILLGTSRKSMIGQTLNLPMEERLE
GTLATSVVGVAAGVDILRVHDVQANKRAVQMADAIYRRKRGENFSGA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattattccctgcgctggattgacctgaacaacgaaatggaagctaaaaaggct
atgcaacacatcggttccgacccagggggaattgcccatatggttggtaagcctattggg
agagctctcaagcttgagaatgtgcccttgccagcggcccatatcattaagcaggaaatg
ctttctctgggaggggacgcagcagttcatcgtaatgtcattgtcaataagattgaagcg
accgatattctgctggtggggacgacgaaacattttcgccggctcagtcagaagctggcg
gctcaaccctttggcttaaaagatttgggcaagagcttaaaaagccttcttgaagccctg
gaacctcctaagcaaagggttctctcctgtcgcgggaaggaaattgtgctgggtgagcgg
accctgattatgggaatactcaacctgacgccggactccttctcagatggaggaaaattt
aatacctttgaacatgccatcaaacaagctgaagctttggttgagcagggggcagatatt
ctggatatcggagcagagtccacccgcttaaaacatgatccggtcagtgccgaagaagaa
tggaatcgcctggaggcagtcatcaaggctttattgccacggctttctattccgatctcc
gtggatacgtataagtcggaagtggcggagaaggcactggacgctggggtacatatgatt
aatgatatctggggattgcaaaaggaccttaaaatggcggaggttgcaggtaaatatcag
gcgccggtgattgtcatgcataaccaagaagggaacagctaccaccatgtcatgggggat
atgatggccttcttaaaaaagagcattcatcttgctgaagaacaggggctaactggtgac
cagattatcatcgatccgggcattggcggaacagccttcggcaagagcctggatatcgat
ctggaaatcatgagtcgtttaggggagttccggtctttagggcaccccatactcttggga
acgtcccggaaatccatgattggtcaaaccctgaacctccccatggaggaacggttggaa
ggaacccttgccaccagtgtggtaggtgtagccgctggagtggatattcttcgggttcat
gatgtgcaggccaataagagagcggtacagatggcggatgccatctatcgtcgcaagaga
ggagagaactttagtggcgcgtga

DBGET integrated database retrieval system