KEGG   Desulfitobacterium dehalogenans: Desde_0462Help
Entry
Desde_0462        CDS       T02146                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desde_0462
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desde_0462
   00620 Pyruvate metabolism
    Desde_0462
   00640 Propanoate metabolism
    Desde_0462
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desde_0462
   00680 Methane metabolism
    Desde_0462
Enzymes [BR:ddh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desde_0462
Lipid biosynthesis proteins [BR:ddh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desde_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(462872..464803)
Genome map
AA seq 643 aa AA seqDB search
MEEKNLEALLEEDRQFAPGEEFRKNAVIQSAEIYEQGKSLSFWEEQAKQLSWLNPWEKTL
EWNPPFAQWFVGGKLNASANCLDRHLHDWHRNKAAIIFEGENGDSQVLTYQDLHREVSKF
ANVLKANGVKKGDRVTIYLPMIPEAVISMLACARIGAPHSVVFGGFSSEALRDRVIDAQA
KAVITSDGSFRRGNTIPLKDNTDIALDGVDCVEHVFVIQRTKQAVQMKEGRDLWYHEEMK
EASAVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTTGGYMVGVSTTHRWVFDLKEEDVYW
CTADVGWITGHSYIVYGPLANGATVLLYEGSPDYPKRDRFWEIVEKYKVTILYTAPTAIR
TFMKWGPQYPQSRDLSSLRLLGTVGEPINPEAWMWYYKYIGGERCPIVDTWWQTETGMIM
MTPLPGITSLKPGSCTVPFPGVRIEVVDNSGNPVPKGSGGYLAIKEPWPSMLRNIYGDPE
RFERTYFGNWPGVYFPGDGAKWDKDGYFWILGRVDDVINVSGHRIGTMEVESALVDHPSV
AEAAVIGKNHEVKGQALACFVTLKEGIEITPGLEDELKKHVAKKIGALARPDDIFFTAEL
PKTRSGKIMRRLLRDIAEGRAIGDTTTLADASVVNTLKANYQE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaatcttgaggctttgttggaagaagatagacagttcgcccccggtgag
gaattccgcaaaaatgcggtcattcaaagcgcggaaatctatgagcaggggaagagcctc
agcttttgggaagaacaggctaaacagctctcctggctgaacccttgggagaaaaccctg
gagtggaatccaccctttgcccagtggtttgtcggcgggaaactcaatgcctccgccaac
tgtctggatcgccatctccatgattggcatcgcaacaaagccgccatcatctttgaagga
gaaaatggggatagccaagtccttacctatcaggatctccatcgtgaagtctctaaattc
gccaatgttctcaaggccaatggggtgaaaaaaggagatcgggtcactatctatctcccc
atgattccggaggccgtgatttccatgctggcttgtgcccggattggggctcctcacagt
gtggtcttcgggggcttcagctcggaggccctgcgggaccgggtcattgatgctcaggct
aaagccgtgattacttccgatggcagcttcagacggggcaataccatccccttgaaagat
aacaccgatatagccttggacggcgtggactgtgtagaacatgtcttcgtcatccagcgg
accaagcaagccgtgcaaatgaaggaaggccgggacctttggtatcatgaagaaatgaaa
gaagcctcggccgtgtgtccggcggagcccatggacgcagaggatatgctctttatcctc
tacaccagcggcaccacaggtaagcccaaaggagtagtccataccactgggggctatatg
gtgggagtatccaccacccatcgctgggtctttgatctaaaggaagaggatgtttactgg
tgcacagccgatgtggggtggattaccggtcattcctatattgtctacggccctttggct
aatggagccaccgtccttctctatgaaggaagtcccgattatcccaaacgggatcggttc
tgggagatcgtcgaaaaatacaaagtcaccattctctatacagcccccactgccatccga
acctttatgaagtggggcccccaatatccacaaagccgggatttatccagcttgcgctta
ttaggtaccgtgggcgagcccatcaatccggaggcctggatgtggtactacaaatacatc
ggcggagaacggtgccccatcgtggatacctggtggcagactgaaacgggcatgattatg
atgacccctctgccaggcattacctccctaaaacccggttcctgcaccgttcctttccca
ggagtccggatcgaagtggtggataacagcggcaatcctgttcctaagggaagcggcggc
tacctggccattaaggagccttggccttctatgctgcgcaatatctacggagacccggaa
cgcttcgagcggacgtactttggcaactggccgggagtctacttccccggagatggagcc
aagtgggataaggacgggtatttctggattctcggccgggtggatgatgtcatcaacgtc
tccggtcatcggatcggcaccatggaagtggaaagcgctttagtggatcacccctctgtt
gccgaggccgccgtcatcggcaagaaccatgaagttaaagggcaagctctggcctgcttc
gtcaccttgaaggaaggcatcgaaatcacccccggtctggaagacgaactgaagaaacat
gtggccaagaagatcggagcattggcccggcctgatgatatcttcttcactgccgaactg
cccaagacccgcagcggaaaaatcatgcgccgcctcttaagagatattgccgaaggacgt
gctatcggtgataccaccaccttagccgatgcctctgtagtcaatacgcttaaagccaat
taccaggagtaa

DBGET integrated database retrieval system