KEGG   Desulfitobacterium dehalogenans: Desde_0628Help
Entry
Desde_0628        CDS       T02146                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desde_0628
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desde_0628
Enzymes [BR:ddh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desde_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647563..648468
Genome map
AA seq 301 aa AA seqDB search
MERRKVRIIGVPIDLGADRRGVDMGPSAIRYAGLHERLKKLGWEVEDVGNIDVPIAETRE
IKDPLLKYLPEISEVNEKLYPLVAQAIKEGVIPLVIGGDHSLGIGSLAGCAASGKQFGVI
WFDTHGDYNSVDTTSSGNIHGMPLAVANGIGVEELVRIGGADRKIKEENTVIIGARDFDD
EERDMIRQSKITVFSMSDIDRLGMEVVVRQGLEIANQGTDGVHISFDLDVLDPSEAPGVG
TPVQGGITYREAHLAMEMVADCQCLLSMDVVEVNPILDVQNKTAELAVGLIGSAFGQKIY
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaaaggtacgcatcattggagtacctatcgacttaggagcggatcggaga
ggagtggatatgggacccagtgccattcgctatgcagggctccatgaacgtttaaaaaag
ttgggctgggaagtggaggatgtgggcaatattgatgtccctatcgccgagacccgggaa
attaaagatcctctgctcaaatatctcccggagatttcagaagtcaacgaaaagctctat
cccctggtggctcaagccattaaggagggagtgattcccttagtcatcgggggagatcac
agcttaggaataggttctttagcggggtgtgctgccagcggtaagcagtttggagttatt
tggttcgacacccatggcgattataactccgtggataccacttccagcggcaatattcat
ggaatgcctttagctgtagccaatggtattggggttgaggagttagtccgcattggtggg
gctgaccggaagatcaaggaagagaacactgtgatcatcggggccagggactttgatgat
gaagagcgggatatgatccgccaatctaaaattacggtgttttccatgagcgatattgac
cgtttggggatggaagtagtggttcgtcaagggctggagattgccaatcaaggcactgac
ggagtccatatcagctttgatctggatgtgctggatcccagtgaagctcctggtgttgga
accccagtgcaggggggcataacctatcgggaagctcatttggccatggagatggttgcc
gattgccaatgcctgctgagtatggatgtagtggaggtcaaccccattctggatgtacaa
aataagaccgcagaattagccgtaggcctcatcggctcagcttttggacagaagatttat
ccatga

DBGET integrated database retrieval system