KEGG   Desulfitobacterium dehalogenans: Desde_0997Help
Entry
Desde_0997        CDS       T02146                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desde_0997
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Desde_0997
Enzymes [BR:ddh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desde_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023208..1024479
Genome map
AA seq 423 aa AA seqDB search
MRKKTIAILGIVSLVLVLGFVFLSQRINLQDFNTPMSGQQGGNNPTAPSEETPVIDPLKE
RIQAMTLEEKVGQLVMVGVDGYEINANAQQLIQNYHVGGFVLLKKNVNDTQQMLKLLNAL
KDTNGVNKIPLFLALDEEGGRVSRMPSEFKKMPSSLRVGAQNNGALGKRMGEILGREVKE
FGMNMNFAPVLDIFSNPKNTVIGDRAFGNTPELVSKVGIQAMGGIQDQGIISVVKHFPGH
GDTSVDSHVGLPRVDYDLERLRNFELVPFAEAIANDVDAIMLAHILLPKIDPDYPASFSE
ALISDILRKEMSYDGVVITDDMTMGAIVENYSIGEAAVKSILAGSDIVLVCHDFAKEEAV
LKEILNAAETGKIPSDRIDESVYRVLKLKEKYALADRQIDSVDVQGINAEIEQLYKNYPA
LKG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaaaacgatagcaatactcggaatagttagtttagtcttggttttaggattt
gtctttttatcccaaaggataaaccttcaggattttaacactcccatgtcaggtcaacaa
gggggcaataatccgaccgctccctcagaagagactcctgtgattgacccccttaaggaa
cggatccaagcgatgaccttagaggagaaggtcggacaactggtaatggtgggagtggac
gggtatgagatcaatgccaatgctcagcagttaattcagaattaccatgtgggtggtttt
gtacttttaaagaaaaatgtgaacgatactcagcagatgttaaagttactcaatgcatta
aaagacacgaatggagtcaataagattcccttattcttagctcttgatgaagaaggaggc
agggtatccaggatgccttcagaatttaaaaagatgccttccagtctgcgggttggagca
cagaataatggggctttagggaaaagaatgggagaaatcctgggcagggaagtcaaagaa
tttgggatgaatatgaatttcgccccagttctcgatattttcagtaatccaaagaacacg
gttatcggtgatcgtgcatttgggaatacccccgagcttgtcagtaaagtgggaatacaa
gccatgggaggaattcaggatcaaggtattatctctgtagttaaacattttccgggtcat
ggggatacttcagtggattcccatgtgggattacccagagttgattacgatttggaacga
ttaaggaactttgaacttgttcctttcgcagaagccattgccaatgatgtggatgccatc
atgctggcccacatcttgctgccgaagattgatccggattacccggcatccttttcggaa
gctctcatcagtgatatccttcgtaaagagatgagctatgacggggtcgtcattacggat
gatatgaccatgggggctattgtggagaattatagtatcggtgaggccgcggtgaaatcc
atcctggcaggcagcgatattgtactggtctgccatgatttcgctaaggaagaggctgta
cttaaggagatccttaatgctgcggagacgggtaaaattccatcggaccggatagatgaa
agtgtttaccgtgtcttaaagttgaaagagaagtatgctttagctgaccgacaaatagac
tcagtggatgtacaaggtatcaacgccgaaattgagcagctttataaaaattatccggct
ttaaaagggtag

DBGET integrated database retrieval system