KEGG   Desulfitobacterium dehalogenans: Desde_1062Help
Entry
Desde_1062        CDS       T02146                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ddh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1077791..1080034
Genome map
AA seq 747 aa AA seqDB search
MATATAARMKKGKETVKPVATLAGKIISVRFHNPQNGYSVISIEPKDMVETGMVSCSAVG
NLAAVRVGDEYEFAGEWKEHPQYGRQFAFCKADVVLPKEKTGAATYLATLAYGVGFAKAK
RIVDRLGDDALNRIIEAPALLDQFHFLSPQQREEIQEGLLKNTRLAELAALICKEGVGIG
TATRIFNTYGQASVSIVKENPYVLADEVYGIGFKVADRIGMGLSIAPDSPYRVESAYMYA
LREAGNDGHVYLTPKDTIVALDGLLGKQSMVGVSNIKDAYAELEQRGLVCREGDAIYVAS
MLAEEKQLARDIVRLAQMDGKYLSTDTEQKLEEVTEAMQAEFGVIYAPEQKEAIKKSFYK
SLSVVTGGPGTGKTTVIKGIIEAYRKIARSNLIMLAAPTGRAAKRMTEATGCDASTIHRL
LKFNPMINGFEHDADNQLPAGLLIVDEYSMSDLHLAKCLFEAVPSDMLMVIVGDVDQLPS
VGPGKVLEDIIESRQVITTRLKFNYRQASGSRIALEASRVVEFGECRLYQDEKDWKTILE
DEPEKAVTRIKAEVRAALAQGLGIMDFQVLAPMKKGLVGVDNLNEVIREIVNPPDVLKPE
KKTGKDKFFRLGDKIMVIRNNYKLGVFNGDIGVIQGIDSSSIAVDFEGEMVTFSEDNIND
LTLAYASTIHKSQGSEFPLVIMIIMRSHYIMLQKNLFYTGFTRAKQRLVLVCQESAVKRC
LDNAEKKERHTLLRDRIIAYAGASQSA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcaacagcagcgcgaatgaaaaaaggaaaagagacggttaagcctgtcgct
actctggccggaaaaatcatatctgtgcggtttcataatcctcaaaacggttactccgta
atctctatagagcctaaagacatggtggaaacgggtatggtctcctgcagtgccgtcggc
aatctggcggcggtcagggtaggggatgaatacgaattcgccggcgagtggaaagagcat
ccgcagtacgggcggcagttcgcattctgtaaggccgatgtggttctgcccaaggaaaag
accggggcagccacctatctggccaccctggcttatggggtagggtttgcaaaggcgaaa
cggattgtcgataggctaggggacgatgcccttaaccgaatcattgaggccccggcttta
ctggatcagttccactttctttctccccagcagcgggaagagattcaggaaggattgctt
aaaaacaccaggcttgcggagctggcagccctcatatgcaaagaaggtgtcggcattggc
acggcaacaagaattttcaacacctacggccaggccagtgtgtctatcgttaaagaaaat
ccctatgtgttggctgatgaggtgtacggcatcggcttcaaggtagccgacaggatcggg
atggggttgagcatcgctccggattcgccatatcgggtagaatcggcctatatgtacgct
ctccgggaagccggcaatgatggccatgtctatctgaccccaaaggataccatcgttgcc
ctggatgggttgctgggtaaacagtccatggtgggagtgagcaacatcaaagatgcttac
gctgagcttgagcagcgggggctggtttgccgggaaggagacgctatttatgtagcctcc
atgttggccgaggaaaagcagctggcccgagatattgtccggctggctcagatggacggg
aaatatttgtccacggataccgagcaaaagctggaggaagtcactgaagccatgcaggca
gaattcggcgttatctatgccccggagcagaaagaggccatcaagaagagcttttataaa
tcattgtcagtagtgacaggtggcccgggaaccgggaagacgactgtcattaaaggcatc
attgaggcttatcggaaaatagccagaagcaacctgattatgctagcggcaccgacgggc
cgggcggcgaagaggatgacggaggccaccggatgcgatgcctctaccatccaccgactg
ctcaaattcaaccctatgatcaatgggtttgagcacgatgcggataaccaacttcctgcc
ggtctgttgattgtggatgaatactccatgagtgacttacacctagctaagtgcctcttt
gaggcagtaccaagtgacatgttgatggtcatcgttggtgacgtggatcagctccccagc
gtcgggccgggaaaagtactggaggacattattgaatcccgtcaggtcatcacaacccgg
ctaaagttcaactaccggcaagcctccggtagccgcattgcccttgaggcatcccgggtg
gttgagttcggagaatgccgcctttaccaggatgaaaaggattggaagactatccttgaa
gatgagccggaaaaggctgtcacaagaatcaaggccgaagtaagggcggctctggcccag
gggttggggatcatggattttcaagtgctggcccccatgaaaaaggggcttgttggggta
gataacctgaatgaagtgattcgggaaattgtgaatccacccgacgtattgaagccggaa
aagaagactggtaaagataaattcttccgtcttggtgacaagatcatggtgatccgcaat
aactacaagctgggagtgtttaacggagatatcggggtgattcagggaattgattccagt
agtattgctgtcgactttgaaggggaaatggttacgtttagcgaggacaacatcaacgac
ctaaccctggcctatgcaagcacaatccacaaaagccaggggtcagagttccctctcgtg
atcatgattattatgcggagtcactacatcatgctgcagaaaaatctattttacactggc
tttacccgggctaagcagcgcttggtgctggtgtgccaggagagtgccgtgaagcggtgc
ctggacaatgccgagaaaaaagaacggcacacgctcttacgggataggatcatagcctat
gcaggcgccagccaatcagcttaa

DBGET integrated database retrieval system