KEGG   Desulfitobacterium dehalogenans: Desde_1952Help
Entry
Desde_1952        CDS       T02146                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ddh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1980065..1980886
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETIRRSLCQRILNLRIEDILIRWPGAVEGYEGKTFADTVKGLRIQSIERRGKY
LLFTLEEGWSFIAHMRMTGRLVYHAQGQEPEKHTHVVLKLSSGEVHFTDTRKFGRLQLVR
TEERLKQPSLARLGPEPLEGGFSAEELARRLAPRKLAIKAALLDQNLLAGVGNIYADEAL
FRAGIAPERCANSLTKEETEKLYTAICQVLEEGIAANGTSFRDYQDANGEKGDFQKELNV
YGRGGEACKCCGHTLERIRLAGRSTVFCPRCQR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactaccagaagtagaaaccattcgcagaagcctgtgccagcgcattcttaat
ctaaggattgaggatatcctgattcgttggccaggtgctgtagagggatatgaagggaaa
acctttgcagatactgtcaagggattgaggattcaaagtatcgaaagacgtgggaaatac
cttttgtttaccttagaagagggctggtccttcatcgctcatatgcgcatgacaggacgc
ttggtttaccacgcccaaggacaagaaccggaaaagcatacccatgtggttcttaagcta
tcttcaggtgaggttcattttaccgatacgcgcaaattcggccggctgcagttagtgaga
actgaggaacgcctcaaacaaccctctttagcccggttgggtccggagcctttagaaggc
ggctttagcgcggaagaattggcacggcgcctggctccccgcaagctggctattaaggca
gccctcttggatcagaaccttctggcgggagtcggcaatatctatgccgatgaggcctta
tttcgggcggggattgccccggagcggtgtgccaattctttgacgaaagaggagacagag
aagctttatactgccatttgtcaagttcttgaggagggtatcgccgccaatggcacctct
ttccgggattatcaggatgctaatggagaaaaaggcgactttcaaaaggaattgaatgtc
tatggtcgtgggggagaagcgtgtaaatgttgcggccatactctggaaagaattcgtctg
gccggcaggtcaactgtgttttgcccccgctgtcagaggtaa

DBGET integrated database retrieval system