KEGG   Desulfitobacterium dehalogenans: Desde_2138Help
Entry
Desde_2138        CDS       T02146                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desde_2138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desde_2138
   00020 Citrate cycle (TCA cycle)
    Desde_2138
   00620 Pyruvate metabolism
    Desde_2138
   00640 Propanoate metabolism
    Desde_2138
   00650 Butanoate metabolism
    Desde_2138
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desde_2138
   00680 Methane metabolism
    Desde_2138
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desde_2138
Enzymes [BR:ddh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desde_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2142100..2142378
Genome map
AA seq 92 aa AA seqDB search
MVLKELPVVPSAEPGSLAESPNSAIQRIVRPVIIDQTLVNPIVLLYCPDGALFLKGDEIV
VSYKHCKGCGICAKESEGIEMVPEYTGPRGIF
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaaggagctgcctgttgttccttcagctgaaccaggttccctggcggaatca
ccgaattcagccattcaacgtattgttcgtccggtgattattgatcagaccttggtcaac
cccattgttctgctttattgcccggatggagccctctttttaaagggagacgagatcgta
gtgagttataagcattgcaaaggttgcggcatctgtgccaaagaaagtgaaggaattgag
atggtgccggaatacacaggtccacgaggaattttttag

DBGET integrated database retrieval system