KEGG   Desulfitobacterium dehalogenans: Desde_2139Help
Entry
Desde_2139        CDS       T02146                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:ddh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ddh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ddh00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ddh00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ddh00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:ddh00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:ddh00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:ddh00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2142400..2143548
Genome map
AA seq 382 aa AA seqDB search
MNKALITGSEAAALGAKLAQIEVLGYYPITPAFPAMERLSKYIEDGELHCKFIRVESDHS
ALAAVLGASLAGARSYTVTNSQGLLLMTEVVYHAAGLRQPIVMGVANRALSAPHSRFPEH
GDAISQGASGWIQMFCENNQDIMDNTIQAFRVAEELRTPVMVNYEGYIQSHTLEEVYIPE
QEKVAKFLPLNRQPALDINNPRGVNTVTGPEFYTDYKYQQNQAMLQALTLIPQTAEAYNA
EFGTTSCGLVEGYKTEDAEHVIVAMGSIVGTARVLVDELRKEGKKIGVLKVKVWRPFPAE
AILAQIKNAKYVTVLDKNIVFGVGGALATEIKAASYGYGNQVINGVILGLGGRQCGIPEV
KEAVEHTENSNSKTNTSAWIGL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcacttattacaggaagtgaagcagctgccctaggtgccaagctcgctcag
atcgaagtgctggggtattaccctattacccctgcttttccagctatggaaagactaagc
aaatatattgaggacggagaacttcattgtaagttcataagagtggaatccgatcatagt
gcccttgcagcggtgctgggggcctcattagccggagcacgcagttatacagtaacgaac
tctcagggattattgctcatgacggaagtcgtttatcacgcggcaggtcttcgtcaaccc
attgtcatgggagtagccaatagagctttatcagctcctcacagccgttttccggaacat
ggtgatgcgatctcccaaggagccagcggatggattcaaatgttctgcgaaaacaatcag
gatattatggataacaccattcaggcgttccgtgttgccgaggaactacgcactcccgtt
atggtgaactacgaaggctatatccaatcccatacattggaggaggtctatataccggaa
caggagaaagtggcaaaattcctccctttaaaccgtcaacctgctcttgatattaataac
cctaggggagtaaataccgtcaccggccctgaattctacactgattataagtatcaacaa
aaccaggctatgcttcaggcactaaccctgattccgcaaacagctgaagcctataatgct
gagttcggcacaacctcttgtgggcttgtagagggatataaaacagaagatgctgaacat
gtgatcgtggccatggggtctattgtcggtacagcaagggttttagtggatgaattgaga
aaagagggcaagaagatcggagtattaaaagtcaaggtttggaggcccttcccagcagaa
gcgatcttagcccaaataaaaaatgctaagtatgtgacagtgctggataaaaatattgtt
ttcggtgtgggaggagctttagccacagagattaaggcagcttcctatggttatggaaac
caagtgatcaatggggtaatccttggactaggcggacgccaatgcggcattccagaagta
aaagaagcagtggaacatacggagaacagtaactcaaagacaaatacttccgcatggatc
ggattataa

DBGET integrated database retrieval system