KEGG   Desulfitobacterium dehalogenans: Desde_2140Help
Entry
Desde_2140        CDS       T02146                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desde_2140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desde_2140
   00020 Citrate cycle (TCA cycle)
    Desde_2140
   00620 Pyruvate metabolism
    Desde_2140
   00640 Propanoate metabolism
    Desde_2140
   00650 Butanoate metabolism
    Desde_2140
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desde_2140
   00680 Methane metabolism
    Desde_2140
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desde_2140
Enzymes [BR:ddh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desde_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2143563..2144420
Genome map
AA seq 285 aa AA seqDB search
MIDFKELPKEELFGQGNVGCKGCGAAIAGRQAMKVLGERTIITIPASCMATLGGNNTKTT
WGVPFYHTLFECAPAVSSGIRAALEIQGIKDVHVVSWGGDAGSADIGFQSLTGAAERQEH
MIHVLYDNEMYMNTGGQTGSQTPLYAMTSNSALGKTVHKKNMLAIMEAHGIDYVASANIA
YPEDLMAKFQKAAAKKGFSYIHILAPCHRGWQIKPEETIEISRKATECGLWELFEVDEGK
RTRTYEPSFTPVADYLKSQGRFKHLNEDHISSFQKSVDTYYGRGE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttaaagagcttccaaaagaagaactgtttggacagggcaatgtgggatgt
aaaggatgcggagcagcaatcgccggaagacaggctatgaaggttcttggcgaacggact
attatcacaatcccggcatcttgtatggccaccctgggtggtaataataccaaaacaacg
tggggagtgcctttctaccataccttgtttgaatgtgctccggcggtatcctcaggaatt
cgagcagccctggagatccagggaattaaggatgttcatgttgtatcctggggcggagat
gcagggagtgcggatatcgggttccaatcccttacaggtgcggctgagcgtcaagaacac
atgattcatgttctctatgataatgaaatgtatatgaatacaggcggtcaaaccggcagc
caaactcccttatatgctatgaccagtaatagtgctttagggaaaacagttcataagaag
aacatgctggctattatggaagctcacggtattgattatgttgccagtgcgaatatagct
taccctgaagatctcatggcgaagtttcaaaaggctgccgctaagaaaggtttctcctat
attcatatcctggccccttgtcaccgcggttggcagatcaaacccgaagaaacgattgaa
atctccaggaaggcaactgaatgcgggctctgggaactctttgaagtcgatgaaggaaaa
agaacccggacttacgagccgagctttactccagtagcagattatcttaaatcccaagga
cgttttaaacatttaaatgaggatcacatttcaagttttcaaaaatctgtggatacctat
tatgggcgaggggagtga

DBGET integrated database retrieval system