KEGG   Desulfitobacterium dehalogenans: Desde_2225Help
Entry
Desde_2225        CDS       T02146                                 

Definition
(GenBank) peptidase family protein
Organism
ddh  Desulfitobacterium dehalogenans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2234899..2235909)
Genome map
AA seq 336 aa AA seqDB search
MPYDHKPLDYTLLERLTQCFGPSGVEGRVTSLIAEEIRPYCDEINTDALGNLIAVRRGTG
KKIMIAAHADEIGVMITHIDEKGFLRFAPIGGVSIQGLPHRRVEFQNGVIGTIGVEKLEK
PSDLKLNKLYIDIGSASFEESKAKVQVGESAVFVGRFHKQEKRLTSKALDDRVGCFIAIE
VLKRLQTLHEVYFVFTVQEEVGVRGAQTAAFALEPDLALAVDVTGTGDTPKSHPMDVKLG
YGAAIKVFDRSMITHPKIKSWMAQTAEQNHIPYQWEVLEYGGTDSGAIHLTKGGIPSGVV
SIPTRYIHSPSETVDQGDIEGAAQLLLALLEGPAEL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgatcacaaacctttggattatacacttttggagcgattaacccaatgcttt
ggtccatcgggtgttgaaggaagagtgacatcccttattgctgaagaaattcgtccctac
tgtgatgaaataaacacggatgccttgggaaaccttattgcagtacgtcggggaacaggc
aaaaaaattatgattgcagcccatgccgatgaaatcggggtgatgatcactcatattgat
gagaagggttttttgcgttttgcccctattggcggtgtctcaattcaggggttacctcac
cgccgggttgagtttcaaaatggagtcattggaaccatcggggtagaaaaacttgaaaaa
ccaagcgatttaaagctgaataagctctatatcgatatcggatccgcatcctttgaggaa
agtaaagctaaggttcaggtaggagaaagcgctgtctttgtgggacgcttccacaaacaa
gaaaagcgccttacctcaaaagctctggatgacagggtgggatgctttatcgctatcgaa
gtgctgaaacgtctccaaactctgcatgaagtgtattttgtctttacagtacaggaagag
gtgggggttcgtggtgctcaaaccgcggcctttgccctggaacccgatttagcccttgct
gtggatgttaccggaacgggggacacccccaagtcccaccctatggatgtgaagctggga
tatggtgcagcgattaaagtatttgaccgttctatgattacccaccccaagattaagtcg
tggatggctcaaaccgctgaacagaatcatattccttatcaatgggaggttctagaatat
ggcggtacagattccggggctatccatctgaccaagggaggaatcccttccggggtcgtg
tccattcccacccgctatatccatagtccctcggaaactgtggatcaaggggatattgag
ggagctgcacaattgcttctggctctcctggaaggacctgctgaattgtaa

DBGET integrated database retrieval system