KEGG   Desulfitobacterium dehalogenans: Desde_2462Help
Entry
Desde_2462        CDS       T02146                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desde_2462
   01230 Biosynthesis of amino acids
    Desde_2462
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desde_2462
   00030 Pentose phosphate pathway
    Desde_2462
   00051 Fructose and mannose metabolism
    Desde_2462
   00052 Galactose metabolism
    Desde_2462
  Energy metabolism
   00680 Methane metabolism
    Desde_2462
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desde_2462
Enzymes [BR:ddh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desde_2462
Protein phosphatases and associated proteins [BR:ddh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desde_2462
Messenger RNA biogenesis [BR:ddh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desde_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2477617..2478588)
Genome map
AA seq 323 aa AA seqDB search
MSRIIKRIAVLTSGGDAPGMNAAIRSVVRKGIYHGLEVFGIRKGYEGLIHGEFIAMNLGA
VADIIHRGGTMLMTARSQEMTTPEGQKNAAAQLRYREIDALIVIGGDGSFRGAQTLSAQG
IPIVGIPGTIDNDITGTDLTIGFDTAVNNVVQAVSKIRDTATSHDRTFLVEVMGRDCGNI
ALQSGVACGAESILVPEIQPDIDDIVAKLERGHQRGKHHSIIMVAEGATSAWNLGEELRR
RTGFETRVTILGHIQRGGNPSALDVVLASQMGAKAVEILCAGETDRMTACVNQEILSLPL
EVAYGERRPFNKGLYDLANQLAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtataatcaagaggatcgctgttctcaccagtggaggcgatgcaccgggaatg
aatgcagccattcggtcagtggtccgcaagggaatttatcatggactcgaggtttttggg
attcgcaaagggtatgaaggcctaattcatggagaatttatagccatgaatttaggagct
gtagcggatatcattcatagagggggtaccatgctcatgaccgctcgttcccaagaaatg
accactcctgagggacaaaaaaatgccgcggctcaattgcgttatcgtgagatcgatgcc
cttattgttatagggggagacggttcttttcggggagcacagaccctgtctgctcaagga
atacctatcgtcggtataccgggtaccattgataacgatattaccgggacggatttaacc
ataggatttgatactgctgtgaataatgtggttcaagcggtcagtaaaattcgggatacg
gcaacttcccatgatcgaactttcttagtggaagtcatgggacgggattgcgggaacatc
gctctgcaatccggcgtagcctgcggtgcagaatccatccttgtgccggaaatccaaccg
gatattgatgatattgtagcaaaattggaacgtggtcaccaacgaggaaagcatcacagt
atcattatggtagcagagggtgccacaagtgcctggaatctaggggaagaactacggcgg
aggacaggcttcgaaactcgggtcaccatcttgggacatattcaaagaggaggcaatccg
agtgccctcgatgtggtcctggcctcgcaaatgggtgcgaaagcagtagaaatactctgt
gccggggaaacggatcgtatgacagcttgtgtcaatcaggaaatcctgtctctgcctttg
gaagtggcttatggtgaacgtagacccttcaataaaggcctttatgatttggcgaatcaa
ttggccatataa

DBGET integrated database retrieval system