KEGG   Desulfitobacterium dehalogenans: Desde_2558Help
Entry
Desde_2558        CDS       T02146                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00020  Citrate cycle (TCA cycle)
ddh00640  Propanoate metabolism
ddh00660  C5-Branched dibasic acid metabolism
ddh00720  Carbon fixation pathways in prokaryotes
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01120  Microbial metabolism in diverse environments
ddh01130  Biosynthesis of antibiotics
ddh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desde_2558
   00640 Propanoate metabolism
    Desde_2558
   00660 C5-Branched dibasic acid metabolism
    Desde_2558
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desde_2558
Enzymes [BR:ddh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desde_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFM00888
UniProt: I4AAA3
Position
complement(2567532..2568809)
Genome map
AA seq 425 aa AA seqDB search
MARFLEYQGKEWLAKAGMPVPKGRPASTPEEAKEIAEWIGGPVAVKGQVQAGGRGKAGIV
KLVNTPDEAAAAAAEILSKTVKGLPVRTVLVEEKLDIKKEFYCSFVVNGAREARSPMLMF
SLEGGMDIESVPEEQLLKINVDPINGLQTYDAVDLAAKAGVAPEELTKFAKFLTKLSQTY
KKYDCMTLEINPFVMTGNGNLICADCKMEIDNSSVGRHPEFGFDIARDLPGEPTELDYIG
WSIEETDARGTGFLMNMGYDEVSPGYIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVASKIYRVAKSVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKPGLPCVL
LLCGNREDESLEILRTGLADLMTSDGPGKRIEIYGKEYVTDTKFIGERLLALSKDYRAEK
EAQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttctagagtatcaaggtaaagaatggcttgcaaaagcaggaatgccggta
cccaagggtcgtccggcatcgacccccgaggaagcaaaagaaattgctgaatggattggc
gggcctgttgcagtaaaaggtcaagtacaagcgggtggtcgtggtaaagcaggaattgtt
aaactggttaacactcctgatgaagcagcagcagctgctgctgaaattctctccaaaaca
gttaaaggtctaccggtgcgcacagttcttgtggaagaaaagctggatatcaaaaaagaa
ttctattgctcttttgttgttaacggagcaagagaagcccgctcgccaatgcttatgttt
agtcttgaaggcggtatggatatcgaaagtgttccggaagagcaattgctgaagatcaat
gtggacccgatcaatggacttcagacttatgatgcagtggacttggctgctaaagcagga
gttgctccggaagaattaacaaagtttgctaaatttttgacgaaactttctcaaacttat
aagaaatacgattgcatgacgcttgagattaaccccttcgttatgacagggaatggaaac
ctcatctgtgctgactgtaagatggaaatcgacaacagttcagtaggtcgtcatccagag
ttcggttttgacattgcccgcgatctgcctggtgagcccactgagttggactacatcggt
tggagcattgaagaaacggatgcccgtggtaccggcttcctaatgaatatgggatatgat
gaagtcagccccggatacattggctatcatcccatcggcggcggttctgccatgatgggc
ttggacgccctcaatcaagtgggtctgaagccggccaactatgctgacaccagtggtaac
cctgtagcctccaaaatctatcgtgtagccaaatcggtactttctcaacccaatattgac
ggatatctccttgggggcttcatgatggccaaccaagaacaatggcatcatgctcatgcc
atagtcaaagttcttcgtgaaatccttccgacccaaaaaccaggactgccttgtgttctc
ctgctttgtggtaaccgggaagatgaatctctggaaattcttagaacgggcctggctgat
cttatgaccagtgacggaccgggaaaaagaattgagatttatggaaaagaatatgtaacc
gatacgaagttcattggtgaaagactcttagccctgagcaaagactatcgggctgagaaa
gaagctcaaggaaagtag

DBGET integrated database retrieval system