KEGG   Desulfitobacterium dehalogenans: Desde_2650Help
Entry
Desde_2650        CDS       T02146                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desde_2650
Enzymes [BR:ddh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desde_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2663586..2667080)
Genome map
AA seq 1164 aa AA seqDB search
MVLAYHNSHEEFFRSPFGAVPCGSLLHLRLLIQKACSVDECLLRLWIQGKEHRLSMSRAE
WPALNRVGIEPRFYPQGMVESEGVVYEVDYSIPPEPGVIWYFFAFKVSEDTYFYGNNHQQ
LGGTGELSHQEPPGYQITVYRPMKLPSWYTRGIIYQIYVDRFFNGEEQGKILNPRPKSLL
HGDWYDTPLYIKDERGAVLRWDFFGGNLLGIIKKLPYLKELGVTILYLNPIFDSSSNHKY
DTGDYLTIDPMYGDEETFIRLILEAQRLGMAIILDGVFSHTGDDSIYFNRYGKYPGLGAY
QSPDSPYYSWYQWKEEKEYSCWWGVKTLPEVQEMEPSYREFIIHSPQGVLQSWMKRGIKG
WRLDVADELPDEFIQELRQAMKAIEPEGVLIGEVWEDPTHKFSYGKLRQYFWGAELDATT
HYPFRQIFLQYFLGEMDACQVHERIMNLYENYPRENFFGQMNLIGSHDRARILTLLGEAP
PPERLSVVEQENYRLSPDDRYLAVRRLKLLTLIQMSFPGVPCLYYGDEAGCEGYPDPYNR
GTYPWEREDQEILRWVKRVLRYRQEYEVLRQGEFYSWSVGKDIYALKRKGEKEEIIVLVN
RNVRESIEVTLKLEQDVQQVIDIFEGKMLYQKEHGLGLFPLILSPLSAKALFCQNQAQNH
YFKQEIMTRSCGILMHISSLPSPWGIGDLGGDAYDFVDFLAEAGQSLWQVLPLNPLGLGD
SPYQSESAFAGNVLLISIDFLIQAGLLTEKEARREWARYGEGAGSKSFAWVESYKEKLLR
KAYERFRKKLPDPPFDSSNQVVGDKPGDKDYLAPHCYDRFIQDNQEWLKDYALYKCLKIK
FSGKAWNQWERKYLVREPEAMEALAIEYAEEINYIFFVQYTFAYQWQRLKDYAHDKGVQI
IGDLPMFVAYDSCDTWAHRENFALDAQNSPLGTAGVPPDYFSPTGQSWGNPLYDWDTLRA
ADYAWWKLRFRQGLHRFDALRLDHFRGFEGYWEVPAQAETAEEGRWLKGPGKGFFESLVR
EFGPLPIIAEDLGTITPEVNTLRAICGFPGTRVIQFSPMEEKGDFVYYSGTHDNDTLLGW
YLSQGYDDRTAMKQVEKTIEELYRGDSAWVILPLQDVLKLDSQARMNIPGTIKGNWKWRV
ESESLTQDVCTWLRGLAEKYRRLS
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
gtggtattggcttatcataattcccacgaggaattctttcgcagcccctttggggccgtt
ccctgcggcagccttctgcatttaaggctgcttattcagaaggcctgttctgttgatgag
tgccttttgcgtttatggattcagggcaaggagcaccggctctctatgagcagggcagaa
tggccggcattgaatagagtggggatagaaccacgattctatccccagggaatggttgag
agcgaaggagtagtctatgaggtggattatagtattccccctgaaccaggagtaatctgg
tatttctttgctttcaaggtaagtgaagatacttacttttatggcaataatcatcaacaa
ttaggaggaaccggtgaactcagccaccaagaacctcccggatatcaaattacagtctac
cggcccatgaaattgccaagctggtatactcggggaataatctatcagatctatgtggat
cgcttcttcaacggagaggagcaaggaaaaatcctcaatccccgccctaagtccttgctg
cacggggactggtatgatacccccctttatataaaggatgaaaggggtgcggtgctgcgc
tgggactttttcggcggcaacctattaggtatcataaaaaaacttccctatcttaaggaa
ttaggcgttactattctttatttgaatcccatctttgattcctccagtaatcataagtat
gatacgggagattatctcaccatcgatcccatgtatggagatgaggaaacctttataagg
ttaatcctggaggcccaacgcttaggtatggcaattattctggacggggtgttcagccac
accggtgatgacagcatctattttaaccgctatgggaagtatcccggcttaggtgcctat
caatccccggattctccctattattcctggtatcaatggaaagaagaaaaggagtattcc
tgctggtggggagtgaaaaccctccctgaagttcaggagatggaaccctcctatcgtgag
tttatcattcactcgccccagggagttctgcagtcctggatgaagcggggaatcaaaggc
tggcgcctggatgtggccgatgagcttcctgacgaattcatccaggagctccggcaagct
atgaaagccatagagcctgaaggggtgcttattggtgaagtctgggaggatcctacccat
aaattcagttatggaaagctcaggcagtatttttggggggcggaactggatgcaaccacc
cattatccttttcggcagatctttctccagtacttccttggggagatggatgcctgccag
gtgcatgaaaggatcatgaatctctatgaaaactatccgcgggaaaactttttcgggcag
atgaatttaatcggcagccatgaccgtgcccggattctgacactgcttggggaagccccg
ccgccggagcggctctcggtagtcgaacaggagaattatcgcttgtctcctgatgatcgg
tatttggctgtccggcggttaaagctgttaaccttgattcaaatgagtttccccggtgtt
ccttgcctatattatggagatgaagcgggatgtgaaggctacccggacccctacaaccgg
gggacttatccctgggaaagggaagatcaggaaatcctccggtgggttaagcgggtgctt
cgttatcggcaggaatacgaggtgctgcgccaaggtgagttttattcctggtcagtggga
aaagatatttatgctttgaaaaggaagggggagaaggaagagattattgtcctggtcaat
cgaaatgttcgggagtctatagaagtgaccttgaagctggagcaggatgtgcagcaggtt
attgatatttttgaggggaaaatgctctaccaaaaagagcatggattgggactctttcct
cttatcttatcccctttatcagcaaaagctctcttctgccagaatcaagctcaaaaccac
tattttaaacaggagatcatgacccgttcctgcggcatacttatgcatatctcctccttg
ccatctccatggggcatcggagacctgggaggggatgcctatgattttgtggatttcctg
gctgaagcaggtcagagcctctggcaggtgctgcctttgaatcctctaggattaggagat
tccccttaccaaagtgagtctgcctttgccggtaatgttttgctcattagtattgacttt
cttatccaggccgggctcctgacagagaaggaagcccgcagggaatgggctagatatggc
gaaggagccggaagtaagagctttgcctgggttgaaagctataaagaaaagctgctgcga
aaagcttatgaacgtttcaggaaaaaactgcccgatcctccttttgactcaagcaatcag
gtggtgggcgacaaacctggggataaggattatttagctcctcattgttatgaccggttt
atccaagacaatcaggaatggctgaaggactatgcgctctataagtgcttaaagattaaa
ttttccggtaaggcttggaaccaatgggaaagaaaataccttgtgcgggaacctgaggcc
atggaagccttggctatagaatatgccgaggaaataaactatatcttctttgttcaatat
accttcgcctatcagtggcaaaggctgaaagattatgcccatgacaaaggggtacaaatc
attggcgatctgcccatgtttgtggcctatgacagttgtgatacctgggcacatcgtgag
aactttgccctggatgcccaaaattctcccctgggtactgccggggtgccccccgactat
ttcagtcctacgggacagagctggggaaatcctttatatgattgggatacccttcgggcc
gctgactatgcctggtggaagcttcgtttccggcaagggctgcatcgttttgatgcctta
aggctggaccatttccgtggttttgaagggtattgggaagttcctgcccaggccgagacg
gctgaagaaggtcgctggctgaaagggccggggaaaggcttttttgaaagcctggtccgt
gagtttggtcctctacccattatcgccgaggatctagggactattactcctgaagtgaat
acccttagagctatttgcggatttccggggacgagagtgattcagttttcccccatggag
gaaaaaggggatttcgtttattactccggaacccacgataacgatacacttttgggatgg
tatttatctcaaggatatgacgacaggactgctatgaaacaagtggagaaaaccattgag
gagctttatcgaggggacagtgcctgggttattcttccccttcaggatgtgcttaaattg
gattctcaggcgagaatgaacattcccggcacaattaaagggaattggaagtggcgtgta
gaaagtgaatctttaactcaggatgtttgtacttggttaaggggtttggctgaaaaatat
aggcggctatcctga

DBGET integrated database retrieval system