KEGG   Desulfitobacterium dehalogenans: Desde_3528Help
Entry
Desde_3528        CDS       T02146                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desde_3528
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desde_3528
Enzymes [BR:ddh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desde_3528
Two-component system [BR:ddh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Desde_3528
Bacterial motility proteins [BR:ddh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desde_3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3530657..3531871)
Genome map
AA seq 404 aa AA seqDB search
MNQPKSPITVLIVDDSPFMRLTLQKILSQDPDIKVLDTARDGKEGIEKLQVLRPQVVTMD
IEMPQIDGLQALSEIMRWQPTPVIILSALTTEGAQASVKALEAGAFDVVAKPSGGPGADI
QALARDLIDKVKAAAQVDPGRLNKKGSVSRTPTNPGSRPAWTAGTAGENVPRAGTSTYQS
SPQGLPSPGNAGSILGSPKGRSLDGGEGLPRYPVEIVAIGTSTGGPSALQAVLTQLPGNF
PVPVLVAQHMPPGFTAPLAQRLNGMSPLTIREGVHGEVLKAGTIYFAPAGKQMQVQSRGS
QLFLHIGDESPITTLYHPSVDVMFLSLAKEVGKGTLGVVMTGMGNDGLRGMREIKERGGY
AIAEAEETCVVYGMPRAIVDAGLANRVVPLGEIARHIVECVQRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcctaaatccccaatcaccgttttgattgtggatgactcaccctttatgcgc
ttaactttgcaaaaaatattaagtcaggatccggatattaaggtactggatacggctcgg
gatggcaaagagggaattgaaaagctacaagttcttcgccctcaagtggtgaccatggat
attgagatgcctcagatcgacggactccaggctttgagtgaaatcatgcgttggcagcct
acccctgtcattatcctcagcgctttgaccacagagggagcccaggccagtgttaaagcc
ttagaagccggagccttcgatgtggttgccaaaccctccgggggaccgggtgcggatatc
caggctttagctcgggatttaatcgacaaagttaaagctgctgctcaagtggatccggga
cgattaaataaaaaaggatccgtaagcagaactccgactaacccaggaagccggccggcc
tggacagctggaaccgctggtgaaaatgttcctcgtgccggtacgagtacttatcagagt
tctccccaaggattaccatccccagggaatgcgggttctatcttaggaagtccgaaagga
cgctccctggatggcggagagggcttgcccagatatccagtcgagattgtcgcgattggt
acctccaccggagggccatccgctttgcaagctgtattaacccagcttccaggtaatttt
ccggtaccggtgctggtggcacagcacatgcctcctggctttaccgcccccttggcccag
cgccttaatgggatgtcccccctcaccatacgagaaggggttcatggggaggttttaaaa
gcaggaaccatttattttgctcccgccggtaagcagatgcaggttcaaagccgtggctct
cagctctttctacatatcggcgatgaatctccgattaccaccctctatcatccatcggtg
gatgtgatgtttctgtccttagcgaaagaggtaggtaaaggtaccctgggtgtggtcatg
accggaatgggaaatgacgggctcaggggaatgcgggagatcaaggaacggggaggctat
gctatcgcagaagctgaagagacttgtgtagtttatggtatgccccgggccattgtggat
gcaggattagccaaccgggtggttcctttgggggagatcgcccggcatattgttgaatgt
gtgcaaaggaggtaa

DBGET integrated database retrieval system