KEGG   Desulfitobacterium dehalogenans: Desde_3744Help
Entry
Desde_3744        CDS       T02146                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01130  Biosynthesis of antibiotics
ddh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_3744
Enzymes [BR:ddh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desde_3744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C FMN_dh PDZ ThiG
Motif
Other DBs
NCBI-ProteinID: AFM02017
UniProt: I4ADI2
Position
3768261..3769067
Genome map
AA seq 268 aa AA seqDB search
MDILERILNEKRKRLRNLEKQTPLSELKRQLKDKVPAICPEKQGLTPNSFHVIAEIKRAS
PSQGIIPWRLSLEETLQAYESGGASLISILTEENFFFGGPEDFQKIRSLTSLPLLRKDFI
FSEYQVIESSVMGADIILLIAGILDAAALSNLLHLTHELGLRALVECRDEEDISQALKAG
AKIIGINNRDLRTFRINLERTQTLSPLIPPNCILVSESGIHTPEDAAFVSKYGAQAVLVG
ESCLLSPDPALHIRSLREAGLGVRTCPG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacattctcgaaagaattctcaatgagaaaagaaaaaggctccggaatcttgaaaaa
caaactcccctttcagagcttaaacggcaattaaaggacaaagtccctgccatctgtccc
gaaaagcaagggcttacccccaattccttccatgtcattgccgaaatcaagcgcgcctcc
ccaagccaggggattataccttggcgtctctccctcgaagaaactcttcaggcttatgaa
tccggtggagcctctcttatctccatactcaccgaggaaaatttcttctttgggggacct
gaggactttcaaaaaatccgctccttaacctcccttccgctcctgcgtaaagattttatc
ttctctgaatatcaggttatcgaaagcagtgtcatgggagcggatataattcttctcatt
gccgggattctggacgctgccgcactatccaatctccttcacctgacccacgaactggga
ttgagagccctggtagaatgccgtgatgaagaggatatttcccaggcacttaaagctgga
gcgaagatcatcggcatcaacaaccgggacctgcgaactttccggataaatcttgaacgc
acccaaacccttagccccctgattccacctaattgcatcctggttagcgaaagtggaatt
catactcccgaagatgctgcattcgtctccaagtatggcgctcaggcagtcctcgtaggc
gaatcctgcctcctgtcccctgatcctgccctgcatatccgctccctgcgtgaagcaggt
ctgggggtgaggacatgcccaggataa

DBGET integrated database retrieval system