KEGG   Desulfitobacterium dehalogenans: Desde_3744Help
Entry
Desde_3744        CDS       T02146                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ddh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3768261..3769067
Genome map
AA seq 268 aa AA seqDB search
MDILERILNEKRKRLRNLEKQTPLSELKRQLKDKVPAICPEKQGLTPNSFHVIAEIKRAS
PSQGIIPWRLSLEETLQAYESGGASLISILTEENFFFGGPEDFQKIRSLTSLPLLRKDFI
FSEYQVIESSVMGADIILLIAGILDAAALSNLLHLTHELGLRALVECRDEEDISQALKAG
AKIIGINNRDLRTFRINLERTQTLSPLIPPNCILVSESGIHTPEDAAFVSKYGAQAVLVG
ESCLLSPDPALHIRSLREAGLGVRTCPG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacattctcgaaagaattctcaatgagaaaagaaaaaggctccggaatcttgaaaaa
caaactcccctttcagagcttaaacggcaattaaaggacaaagtccctgccatctgtccc
gaaaagcaagggcttacccccaattccttccatgtcattgccgaaatcaagcgcgcctcc
ccaagccaggggattataccttggcgtctctccctcgaagaaactcttcaggcttatgaa
tccggtggagcctctcttatctccatactcaccgaggaaaatttcttctttgggggacct
gaggactttcaaaaaatccgctccttaacctcccttccgctcctgcgtaaagattttatc
ttctctgaatatcaggttatcgaaagcagtgtcatgggagcggatataattcttctcatt
gccgggattctggacgctgccgcactatccaatctccttcacctgacccacgaactggga
ttgagagccctggtagaatgccgtgatgaagaggatatttcccaggcacttaaagctgga
gcgaagatcatcggcatcaacaaccgggacctgcgaactttccggataaatcttgaacgc
acccaaacccttagccccctgattccacctaattgcatcctggttagcgaaagtggaatt
catactcccgaagatgctgcattcgtctccaagtatggcgctcaggcagtcctcgtaggc
gaatcctgcctcctgtcccctgatcctgccctgcatatccgctccctgcgtgaagcaggt
ctgggggtgaggacatgcccaggataa

DBGET integrated database retrieval system