KEGG   Desulfitobacterium dehalogenans: Desde_3747Help
Entry
Desde_3747        CDS       T02146                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desde_3747
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desde_3747
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_3747
Enzymes [BR:ddh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desde_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3770765..3771964
Genome map
AA seq 399 aa AA seqDB search
MILKDQDFIPQPNRFGSYGGAYVPETLIPVLDELEQAYYEAREDPGFQKELEELLANYVG
RPSLLYYAQGLSKSLGGARIYLKREDLNHTGAHKINNTMGQILLAKRMGKTRVIAETGAG
QHGVATATACALMGLNCAIYMGEEDVGRQHLNVLRMKMLGSEVHSVTTGSKTLKDAINEA
LRDWVAHPQGTFYCFGTAAGPHPYPTIVRDLQRIIGEETRSQFLNLQGRLPDLLIACVGG
GSNAIGFFHPFLVDKSVGLVGVEAGGIGPGIGEHAATLSLGRPGILHGAYSYLLQDEDGQ
IPDTHSISAGLDYPGVGPEHSYLKDTGRVHYVSVTDAETLEASHLLARTEGILPALESAH
ALAYAIKIAPTLSPEKHIIVNLSGRGDKDMETFAQYIHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattctgaaggaccaagactttatacctcaaccaaaccgtttcggcagctatgggggg
gcttatgtccccgagaccctcatccctgttttggatgaactggaacaggcttattatgaa
gcccgggaagatcccggctttcagaaagagttggaagagctcttagccaactatgtaggg
cgcccttccctcctctactatgcccaagggctcagtaaatccctgggcggggccaggatt
tatctcaaacgggaagatcttaatcataccggtgctcataaaatcaacaacaccatgggg
caaattctcttggccaaacgaatgggaaaaacccgagtcatcgcagagacaggggctggt
cagcacggtgtagccactgctaccgcctgtgcccttatgggcttgaattgtgcgatctac
atgggggaggaggatgtaggacgacagcatttaaatgtcttgcgcatgaaaatgttgggc
agcgaagtccactcggtcactacaggatcaaaaaccttaaaggacgccatcaatgaagcc
ttaagagactgggttgctcacccccagggcactttctactgttttgggactgccgccggt
ccccatccctatcccaccatcgtccgggatcttcagcggattatcggtgaagaaacccgc
tctcaattcctaaatctccagggacgccttcctgatctgctcatcgcctgtgtgggcggg
gggagcaatgccatcggttttttccatccctttttggtcgacaaaagtgtcggactggtt
ggggttgaagccgggggaataggcccgggcataggagaacatgcagccaccttgtcttta
ggccgtcccggcatccttcacggggcttatagctatcttttgcaagatgaggatggtcag
attcccgacacccactccatttcagccggtctcgattaccctggcgtcgggcctgagcac
agctacctgaaagacactggacgcgtccactatgtcagtgtaacagatgccgaaaccctg
gaggccagccatctccttgcccgcacagagggaatcctgcccgccctcgaaagcgcccac
gcccttgcctacgccattaaaatcgcccccaccctttcccccgaaaaacacatcatcgtc
aatttatccggtcggggggacaaagacatggaaacttttgctcaatacattcacgattaa

DBGET integrated database retrieval system