KEGG   Desulfitobacterium dehalogenans: Desde_3747Help
Entry
Desde_3747        CDS       T02146                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desde_3747
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desde_3747
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_3747
Enzymes [BR:ddh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desde_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3770765..3771964
Genome map
AA seq 399 aa AA seqDB search
MILKDQDFIPQPNRFGSYGGAYVPETLIPVLDELEQAYYEAREDPGFQKELEELLANYVG
RPSLLYYAQGLSKSLGGARIYLKREDLNHTGAHKINNTMGQILLAKRMGKTRVIAETGAG
QHGVATATACALMGLNCAIYMGEEDVGRQHLNVLRMKMLGSEVHSVTTGSKTLKDAINEA
LRDWVAHPQGTFYCFGTAAGPHPYPTIVRDLQRIIGEETRSQFLNLQGRLPDLLIACVGG
GSNAIGFFHPFLVDKSVGLVGVEAGGIGPGIGEHAATLSLGRPGILHGAYSYLLQDEDGQ
IPDTHSISAGLDYPGVGPEHSYLKDTGRVHYVSVTDAETLEASHLLARTEGILPALESAH
ALAYAIKIAPTLSPEKHIIVNLSGRGDKDMETFAQYIHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattctgaaggaccaagactttatacctcaaccaaaccgtttcggcagctatgggggg
gcttatgtccccgagaccctcatccctgttttggatgaactggaacaggcttattatgaa
gcccgggaagatcccggctttcagaaagagttggaagagctcttagccaactatgtaggg
cgcccttccctcctctactatgcccaagggctcagtaaatccctgggcggggccaggatt
tatctcaaacgggaagatcttaatcataccggtgctcataaaatcaacaacaccatgggg
caaattctcttggccaaacgaatgggaaaaacccgagtcatcgcagagacaggggctggt
cagcacggtgtagccactgctaccgcctgtgcccttatgggcttgaattgtgcgatctac
atgggggaggaggatgtaggacgacagcatttaaatgtcttgcgcatgaaaatgttgggc
agcgaagtccactcggtcactacaggatcaaaaaccttaaaggacgccatcaatgaagcc
ttaagagactgggttgctcacccccagggcactttctactgttttgggactgccgccggt
ccccatccctatcccaccatcgtccgggatcttcagcggattatcggtgaagaaacccgc
tctcaattcctaaatctccagggacgccttcctgatctgctcatcgcctgtgtgggcggg
gggagcaatgccatcggttttttccatccctttttggtcgacaaaagtgtcggactggtt
ggggttgaagccgggggaataggcccgggcataggagaacatgcagccaccttgtcttta
ggccgtcccggcatccttcacggggcttatagctatcttttgcaagatgaggatggtcag
attcccgacacccactccatttcagccggtctcgattaccctggcgtcgggcctgagcac
agctacctgaaagacactggacgcgtccactatgtcagtgtaacagatgccgaaaccctg
gaggccagccatctccttgcccgcacagagggaatcctgcccgccctcgaaagcgcccac
gcccttgcctacgccattaaaatcgcccccaccctttcccccgaaaaacacatcatcgtc
aatttatccggtcggggggacaaagacatggaaacttttgctcaatacattcacgattaa

DBGET integrated database retrieval system