KEGG   Desulfitobacterium dehalogenans: Desde_3748Help
Entry
Desde_3748        CDS       T02146                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desde_3748
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desde_3748
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_3748
Enzymes [BR:ddh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desde_3748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3771981..3772847
Genome map
AA seq 288 aa AA seqDB search
MSDRLETSLARARLKTPMNPMGMGLITYLMAGDPDSETTLRRLTGLGEVGVDILELGVPF
SDPIADGSVIQSAGLRALQQGINLKKVLNLVARFRKENQDTPLLLMSYLNPLLHYGYDRF
LNDAFTAGVDGLILPDLPWRESTPFRQRAYELLQDRLAFIPMIAQTSRPNHIHDLAQEQK
GFVYVLSRNGITGGDAEIPLQTLQFIHSLQTVLSTPCYVGFGIQSSAQVHKLSQACQGVI
VGSALVKKFAELDSRPLPEQELRCREQDIYTWIGSLRKTPVKEEIACE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatcgcttagaaacatcccttgccagagctcgtcttaaaacacctatgaaccct
atgggcatgggattaatcacttatcttatggccggggaccctgattccgaaacaaccctg
cgccggttaaccggcctgggggaggtgggggtcgatatccttgaactgggcgttcctttc
agtgaccccatcgccgatggctctgtaattcaatctgccggcttacgagcccttcagcag
gggataaatcttaaaaaggtcctaaacctcgtggcccggttccgcaaagaaaatcaggac
actcccctgcttttaatgagctacctcaatcccctgctccattacggctatgaccgtttc
ctcaatgacgctttcacagccggggtcgatggtttgatactgcccgatctgccttggcgg
gaaagcacacctttccggcaaagagcctatgaacttctgcaagaccgattggcctttatc
cctatgattgcccagaccagccggcccaaccacattcatgaccttgcccaggaacaaaag
ggctttgtctacgtcctatcccgtaacgggataaccggaggggatgcggaaattccattg
cagaccctgcaattcattcactctctccagaccgttctttccaccccgtgctatgtggga
ttcggaatccaatcttcagcccaagtgcataaattgagccaagcctgccaaggagtcatt
gtaggcagtgctctggtcaaaaagtttgctgaacttgattcccgccctctccctgagcaa
gagttaagatgccgtgaacaagatatttacacctggattggttcactgagaaagacaccg
gttaaggaggaaattgcatgcgaatga

DBGET integrated database retrieval system