KEGG   Desulfitobacterium dehalogenans: Desde_3874Help
Entry
Desde_3874        CDS       T02146                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desde_3874
   00052 Galactose metabolism
    Desde_3874
   00500 Starch and sucrose metabolism
    Desde_3874
   00520 Amino sugar and nucleotide sugar metabolism
    Desde_3874
Enzymes [BR:ddh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desde_3874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3910801..3911676)
Genome map
AA seq 291 aa AA seqDB search
MSRRQIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDIIIVTG
RNKRAIEDHFDRSIELETFLQKNEKEELLDMVQDIARMVDIYYVRQKEALGLGHAIYCAR
KFIGNEPFAVLLGDDIIHSEVPCLGQMMHIYERHGASIVGVKQVPLEDTSKYGIVDAVPL
DDSLYRAQDLVEKPQPEDAPSTRLAIMGRYILNPEIFGTLENIPPGKGGEIQLTDGLKEL
AKFQEILAYEFDGQRYDVGDKLGFVQATIEYALRREDLSEPLMQYLKQLVK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagacgacagatcagaaaagccattatcccggcagcaggcttgggaacacggttt
ttgcccgccaccaaagcccaacccaaagagatgctccccattgtggataaacccaccatt
caatacatcgtcgaagaagccgttaactctggaatcgaagatatcatcatcgttaccgga
cgcaataaacgggctattgaagaccactttgaccgctccatagaattagagacctttctt
cagaagaatgaaaaggaagaacttctcgacatggttcaagacatagcgcgaatggtggat
atttattatgtgcggcaaaaagaggctttaggcctgggccatgctatctattgtgccaga
aaattcataggaaacgaaccctttgcagtcctcctgggagatgatatcattcattccgaa
gtaccctgtctcggtcagatgatgcatatctatgaacggcatggtgccagtatcgtcggc
gttaaacaggtgcctctggaagatacttcgaaatatggaatcgtggatgcagtccccctc
gatgattctttatacagggctcaggacctggtagagaaaccacagcccgaggatgctccc
agcacccgattagccattatgggccgctatattcttaatcctgaaatctttggcaccctg
gaaaatatccctcccggcaaagggggagaaatccaacttacagatggcttaaaggaattg
gctaagttccaggagattctcgcttacgaattcgatggccagcgctatgatgtaggggat
aagctaggctttgtacaagccaccatcgaatacgccctgcgtcgagaggacctttctgag
ccccttatgcaataccttaaacaactggtcaagtaa

DBGET integrated database retrieval system