KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267536Help
Entry
DDB_G0267536      CDS       T00245                                 

Gene name
hibch
Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0267536 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0267536 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0267536 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0267536 (hibch)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     DDB_G0267536 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 381 aa AA seqDB search
MDRLLTISNHIGKNIRQFSTSTEEVLFEKKGKCLKVLLNRPKALNALNPNMVKILTPKYL
EMKTKKDGEGVIVMKGAGEKAFCAGGDIRAIYDYKQLNEEQKSKTNDIGDLFFREEYILN
NLIGTNPIAQVSIYNGFAMGGGIGLSVHGKFRVATENTVFAMPETGIGFFCDVGGSYFLP
RLPNNYGMYLALTGSKLKGNNVYLAGVATHFVSNEHIQALEKEIEECENPTSQTINSILT
KYHDKSKSTSNEYNDNLGDIERIFGKNSVKEIFEQLELLENSEWAKQTLKTLKSVSPSSL
MVVFEQMKQGAKLPSLAKCLEMEFRISQHFLEKPDFFEGVRALLVDKDKNPKWLPPSIDQ
IDQTLVNSYFKPLSNNKELKF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggatagactattaacaatttctaaccatattggtaaaaatattagacaattttcaaca
tcaacagaagaagttttatttgaaaaaaaaggaaaatgtttaaaagttttattaaataga
ccaaaagcattaaatgcattgaatccaaatatggttaaaattttaacaccaaaatattta
gagatgaaaacaaagaaagatggtgaaggagttattgtaatgaaaggagcaggtgagaaa
gcattttgtgcaggtggtgatattagagcaatttacgattataaacaattgaatgaggaa
caaaaatcaaaaaccaatgatattggtgacttattctttcgtgaagagtacattttaaat
aatttaattggtactaatccaatagcacaagtttcaatctacaatggatttgcaatgggt
ggtggtattggtttgtcagtacacggcaaattcagagtggccacagagaatacagtattc
gcaatgccagagaccggcatcggtttcttttgcgacgtcggtggctcctacttcctccca
agattgccaaataactatggcatgtatctagcactcaccggcagcaaactaaagggtaac
aatgtttacctagccggcgttgccactcatttcgttagcaatgagcatattcaagctttg
gaaaaggagatagaggaatgcgagaatccaacctcccaaaccatcaattccatcctcacc
aagtaccatgacaagtctaaatccacatccaatgaatacaatgataatttgggtgatatt
gaaagaatctttggtaaaaactctgtcaaagaaatctttgaacaattagagttgttggaa
aatagtgaatgggcaaaacaaactttaaaaaccttgaaatcagtttcaccctcctcttta
atggtagtattcgaacaaatgaaacaaggtgctaaattaccatctttagctaaatgtttg
gaaatggaattccgtatctctcaacatttccttgaaaaaccagatttctttgaaggtgta
agagctttgttagttgataaagataaaaatccaaaatggttaccaccatcaattgatcaa
atcgatcaaactcttgtaaactcttattttaaacctttatcaaataataaggaattaaaa
ttttaa

DBGET integrated database retrieval system