KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267674Help
Entry
DDB_G0267674      CDS       T00245                                 

Gene name
glcS
Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DDB_G0267674 (glcS)
Enzymes [BR:ddi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     DDB_G0267674 (glcS)
Glycosyltransferases [BR:ddi01003]
 Polysaccharide
  Storage polysaccharide
   DDB_G0267674 (glcS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 878 aa AA seqDB search
MIFGTPNSTFLENRLGSSTGMPFSSATSLNSGVDQMMNELNIQQPTSHTVLFDLSWEVAK
KVGGIYTVLKTKAPVTVEEYKSRYALIGPYNASTAPTEFEPLIPGPLSSPIIENMMKKYG
IHVHFGKWLVEGYPKVFLIDLHSSMHKLGEWRWDLMSGFEQAGDNETNETIVFGYQSALL
LKEFAEANPNDKYIAHFHEWQASVGLILLKKWKVPVSTIFTTHATLLGRYLAAGGVDLYN
QMQVLNMDFEASKRGIYHRHWIEKKSAADSHVFTTVSEITGYESEHILMRKPDVILPNGL
KLDKFTALHEFQNLHAKYKGVLNEFVRGHFYGHYSDFDLDNTLYVFTAGRHEYFNKGVDM
FLDSLAGLNKLLQQSGSKMTVVAFIIMPAATNNFNVESLKGHSYLKDMRRTCNTIVEAMG
ERLFEATSRGKMISPEELLSQEDLVMLKRRIFALKQKSSGPPVVTHNMINDNDEILQHIR
RIKLFNSQEDRVKVIYHPEFLTSTNPLIPLDYTEFVRGCHLGIFPSYYEPFGMTPAECCA
SGCPSITSNLTGFANYMSRALQDTDSKGIFIVDRRFKSSRETVDQMTQYLWKFTQLDRRQ
RIELRNATEKLSELLDWRTLGKFYKTARALALERAFPPKPISRSPSPSPSSSLKLSTGLS
NQIELQQQQQQQQPQPIGTTINLIPPSSNVSVTPTTTPTTTTTATTATTAPITTPKPNVI
PINTGKENITLLSPNSMSSLLSDSLNEFKKQQQQQQQSKTPTTPTTTSTTTTTPSTTAAA
TNKSVLSNPTPTPSPNTSSFIPTNKGSTATTTTTTATPTPTPSNNTNGKPFNPIEALTKS
NSSSNFATTSTASVNTNNGGTNSPVSKSIPIPSSKSLK
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgatttttggaacaccaaattcaacatttttagagaatagattaggaagtagtacagga
atgccatttagtagtgcaacatcattaaatagtggagttgatcaaatgatgaatgaactt
aacattcaacaaccgaccagtcatacagtattattcgatctttcatgggaagttgcaaaa
aaagttggtggtatttatacagttttaaaaaccaaagcaccagtaacagttgaagaatat
aaatcaagatatgcattaattggtccatataatgcaagtacagcaccaacagaatttgaa
ccattaataccaggaccattatcatcaccaatcattgaaaatatgatgaaaaagtatggt
attcatgttcattttggtaaatggttagtagaaggttatccaaaagtatttttaattgat
cttcatagttcaatgcataaacttggtgaatggagatgggatttaatgagtggtttcgaa
caagcaggtgataatgaaactaatgaaacaattgtatttggttatcaatctgctttatta
ttaaaagaatttgctgaagcaaatccaaatgataaatatatagctcattttcatgaatgg
caagcatcagttggattaatattattaaagaaatggaaagtaccagtttcaactattttt
acaactcatgcaacattattaggtagatatttagcagcgggtggtgttgatttatataat
caaatgcaagttttaaatatggattttgaagcatctaaacgtggtatctatcatcgtcat
tggattgaaaagaagtctgctgctgattctcatgtttttacaacggtttcagagattact
ggttatgaatctgagcatattttaatgagaaaaccagatgttatcttaccaaatggttta
aaattagataaatttactgcacttcatgaatttcaaaatttacatgcaaaatataaagga
gtattaaatgaatttgtacgtggtcatttttatggacattatagtgatttcgatttagat
aatacattatatgtatttacagcaggtagacatgaatattttaataaaggagttgatatg
tttttagattcattagcaggtttaaataaattattacaacagagtggatcaaagatgaca
gttgttgcatttataattatgccagctgcaactaataatttcaatgttgaatcattaaaa
ggtcattcatatctaaaggatatgagacgtacttgtaatacaattgtcgaggcgatgggt
gaacgtttattcgaggcaacgagtaggggtaaaatgatatcaccagaggaactattatca
caagaggatctagttatgttaaagagaagaatctttgcattgaaacaaaagtcaagtggt
ccacccgttgtaactcataatatgatcaatgataatgacgaaattcttcaacatattaga
aggataaaactattcaactctcaagaggatcgtgtaaaggttatctatcatccagagttt
ttaacatccaccaatccattgatacctttggattacactgaattcgttagaggctgtcat
cttggtatctttccaagctactatgaaccatttggtatgacccccgccgaatgttgtgca
agtggttgtccatcaatcaccagtaatctaactggtttcgcaaattatatgagtagagca
ctacaagacactgactctaaaggtattttcatcgttgatagaagattcaaatcctctaga
gaaactgttgatcaaatgactcaatacctttggaaattcactcaattagatagaagacaa
agaattgaacttagaaatgcaactgaaaaattatctgaactcttagattggagaactctt
ggtaaattctataaaactgctcgtgctcttgcactagaaagagcttttccaccaaaacca
atctcaagatcaccttcaccttcaccttcttcaagtttaaaattatcaactggtttatca
aatcaaattgaattacaacaacaacaacaacaacaacaaccacaaccaattggtacaaca
attaatttaataccaccatcttcaaatgtttcagtaacacctactacaacaccaacaact
acaacaactgcaactacagcaactacagcaccaatcacaacaccaaaaccaaatgtaatt
ccaattaatactggtaaagaaaatatcactttattatcaccaaattcaatgtcttcactt
ttaagtgattcattaaatgaatttaaaaaacaacaacaacaacaacaacaatctaaaaca
ccaacaacaccaacaacaacatcaacaacgacaacaacaccatcaactacagcagcggca
acaaataaatcagttttatcaaatccaacaccaacaccatctccaaatacatcatcattc
attccaacaaataaaggatccacagcaacaactacaacaacaacagcaacaccaacacca
acaccaagtaataatactaatggtaaaccatttaatccaattgaagcattaactaaaagt
aacagtagtagtaattttgcaacaacttcaactgcttctgtaaacaccaacaatggtggc
actaattcaccagtatctaaatcaataccaattccttcttcaaaatcattaaaataa

DBGET integrated database retrieval system