KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0268574Help
Entry
DDB_G0268574      CDS       T00245                                 

Gene name
eIF4e
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DDB_G0268574 (eIF4e)
Translation factors [BR:ddi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    DDB_G0268574 (eIF4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 250 aa AA seqDB search
MTTNKDVECLVEPTSNISITEENKNVTSETTTTTNNTQNKETETTDNINKEETADKENKE
EQQQEENPENLIKHPLQNRWSLWYDYQSGKINPEHWVDSLKKVISFDSVEDFWCVFNNLP
NVSNLKQGSSYHLFKDDIEPKWEHESNKRGGKWFVMVKDKSRCDNQWLQSVMACVGETFD
SSDEICGIVYNSRKNGDKISVWTKTAQDEKATRDVGNCLKKILEIDQTIQYTPHEDFIRS
SKGSKNLYEC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaataaagacgtagagtgcttagttgaacctacctcaaatatttcaatcaca
gaagaaaataaaaatgtaacatctgaaacaacaaccaccactaataatacacaaaataaa
gaaacagaaacaacagataatataaataaagaagaaacagcagataaagaaaataaagaa
gagcaacaacaagaagaaaatccagaaaatttaattaaacatcctcttcaaaatagatgg
tcgttatggtacgattatcaaagtggtaaaatcaatccagaacattgggttgactcttta
aaaaaagtcattagctttgattcagttgaagacttttggtgtgtatttaacaatcttcca
aacgtatcaaatttaaaacaaggtagcagctaccatttattcaaagatgatatcgaacca
aaatgggaacacgaatcaaataagagaggtggaaaatggtttgttatggtcaaagataag
agtcgttgtgataatcaatggcttcaaagtgtcatggcttgtgttggtgaaacctttgac
tctagtgatgagatttgtggtatcgtttataactctagaaagaatggtgataaaataagt
gtttggacaaagactgctcaagatgaaaaagcaactcgtgatgttggtaattgtctcaaa
aagattttagaaattgatcaaactattcaatatactccacatgaagattttattagatct
tcaaaaggttcaaagaatttatatgaatgttaa

DBGET integrated database retrieval system