KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0268652Help
Entry
DDB_G0268652      CDS       T00245                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ddi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 332 aa AA seqDB search
MSLCNLAKIRSVAIKAVEKACIACLDIQKQLISEDTINKKDQSPVTVGDYTVQALVINEL
LKGLDEEYPIIAEEDSKTLSSQKDVESKVLSFFNRYSNESFVESQLSSLLDKGNKKKDLN
SSNRWWTLDPIDGTLGFLRKDQYAVALALMEDNKPILGILGCPNLPVSKGSTEKGCIFVG
LKNKGSFMIKLSNLDQEEPIKVSNQSDPTKAIFTESFVSRGFGHELNQKISNSMGVTAEP
LKIDSQCKYAMVARGDSDCYLRLTQLDYKECIWDHAAGHIIVEEAGGIVTDFKKQQLDYS
KGFKLENNVGIVCSNKLLNDSLFDSIKKSIQF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatgtaatttagcaaaaattagaagtgttgcaattaaagcagttgaaaaggct
tgtattgcatgtttagatatacaaaagcaattaatttcagaagatacaattaataaaaaa
gatcaatcaccagtaacagttggtgattatacagttcaagcattagttatcaatgaatta
cttaaaggattagatgaagaatacccaatcattgcagaagaggattcaaaaactttatca
tcacaaaaagatgtagaatcaaaagtattatcatttttcaatcgttattcaaatgaaagt
tttgtagaatctcaattaagttctttattagataaaggtaataaaaaaaaggatttaaat
tcctcaaatagatggtggactttagatccaattgatggtactttgggatttttaagaaaa
gatcaatatgcagttgctttagcattaatggaagataataaaccaattctaggtatttta
ggttgtccaaatttaccagtatcaaagggatcaactgaaaaaggttgtatttttgttggt
ttaaaaaataagggttcatttatgattaaattatcaaatttagatcaagaggaaccaatt
aaggtttcaaatcaatccgatccaaccaaagcaattttcacagaaagttttgtttcaaga
ggatttggtcatgaattaaatcaaaagatttcaaattcaatgggtgtaacagcagaacct
ttaaaaattgacagtcaatgtaaatatgcaatggttgctcgtggtgatagtgattgttat
ttaagattaactcaattagattataaagaatgtatttgggatcatgctgctggtcatata
atcgtagaagaagctggtggtattgtaactgatttcaaaaaacaacaattagattactca
aaaggtttcaaattagaaaataatgttggaattgtttgttcaaataaattattaaatgat
tcattatttgattcaattaaaaaatcaattcaattttaa

DBGET integrated database retrieval system