KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269100Help
Entry
DDB_G0269100      CDS       T00245                                 

Gene name
abpC
Definition
actin binding protein
Orthology
K04437  
filamin
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0269100 (abpC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 857 aa AA seqDB search
MAAAPSGKTWIDVQKKTFTGWANNYLKERILKIEDLATSLEDGVLLINLLEIISSKKILK
YNKAPKIRMQKIENNNMAVNFIKSEGLKLVGIGAEDIVDSQLKLILGLIWTLILRYQIQM
SESDNSPKAALLEWVRKQVAPYKVVVNNFTDSWCDGRVLSALTDSLKPGVREMSTLTGDA
VQDIDRSMDIALEEYEIPKIMDANDMNSLPDELSVITYVSYFRDYALNKEKRDADALAAL
EKKRRETSDASKVEVYGPGVEGGFVNKSADFHIKAVNYYGEPLANGGEGFTVSVVGADGV
EVPCKLVDNKNGIYDASYTATVPQDYTVVVQLDDVHCKDSPYNVKIDGSDAQHSNAYGPG
LEGGKVGVPAAFKIQGRNKDGETVTQGGDDFTVKVQSPEGPVDAQIKDNGDGSYDVEYKP
TKGGDHTVEVFLRGEPLAQGPTEVKILNSDSQNSYCDGPGFEKAQAKRPTEFTIHSVGAD
NKPCAAGGDPFQVSISGPHPVNVGITDNDDGTYTVAYTPEQPGDYEIQVTLNDEAIKDIP
KSIHIKPAADPEKSYAEGPGLDGGECFQPSKFKIHAVDPDGVHRTDGGDGFVVTIEGPAP
VDPVMVDNGDGTYDVEFEPKEAGDYVINLTLDGDNVNGFPKTVTVKPAPSAEHSYAEGEG
LVKVFDNAPAEFTIFAVDTKGVARTDGGDPFEVAINGPDGLVVDAKVTDNNDGTYGVVYD
APVEGNYNVNVTLRGNPIKNMPIDVKCIEGANGEDSSFGSFTFTVAAKNKKGEVKTYGGD
KFEVSITGPAEEITLDAIDNQDGTYTAAYSLVGNGRFSTGVKLNGKHIEGSPFKQVLGNP
GKKNPEVKSFTTTRTAN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctccaagtggaaaaacatggattgatgtccaaaaaaagacttttacaggt
tgggcaaataattatttaaaagaaagaattttaaagattgaagatcttgcaacaagttta
gaagatggtgtacttttaattaatcttttagaaattatttcaagtaaaaagattttgaaa
tataacaaagctccaaagattagaatgcaaaagattgaaaacaacaatatggccgttaac
tttatcaagagtgaaggtttgaaattggttggtattggtgctgaagatatcgttgatagt
caattgaaattaattcttggtttaatttggaccttgattttacgttatcaaattcaaatg
tctgaaagtgataactcaccaaaagcagctctcttggaatgggttagaaagcaagttgcc
ccatacaaggttgttgtaaacaatttcacagactcatggtgtgatggtcgtgttctctct
gctctcactgattccctcaaaccaggtgttagagagatgtcaaccctcaccggtgatgcc
gttcaagatatcgacagatccatggatatcgctcttgaagaatatgaaatcccaaagatt
atggatgccaatgatatgaactctcttccagatgaattatcagtcatcacctacgtctct
tatttccgtgattatgcactcaacaaagaaaagagagatgctgatgctttagctgccctc
gaaaagaaacgtcgtgaaacttcagatgccagcaaggttgaagtttatggtccaggtgtt
gaaggtggtttcgttaataaatccgccgatttccacattaaagccgtcaactactatggt
gaaccattagccaacggtggtgaaggtttcactgttagcgtcgttggtgccgatggtgtt
gaagtcccatgcaaattggttgacaacaaaaatggtatctatgatgcttcatacactgct
accgttccacaagactacactgtcgtcgttcaattagatgatgtccactgcaaagactca
ccatacaacgttaagattgacggttcagatgctcaacactcaaatgcctacggtccaggt
ttagaaggtggtaaagttggtgttccagctgctttcaaaatccaaggtcgtaacaaggat
ggcgagaccgtcactcaaggtggtgatgatttcaccgtcaaagttcaatcaccagaaggt
ccagtcgatgctcaaatcaaagacaatggtgatggttcatacgatgttgaatacaaacca
accaaaggtggtgatcacactgtcgaagttttcctccgtggtgaaccattagcccaaggt
ccaaccgaagttaagatcctcaactctgactctcaaaacagttattgtgatggtccaggt
ttcgaaaaagcccaagctaaacgtccaactgaattcactattcactctgttggtgctgat
aataaaccatgtgctgctggtggtgatccattccaagtatccatcagtggtccacaccca
gtcaacgttggtatcaccgataatgacgatggtacttacactgttgcctacactccagaa
caaccaggtgactacgaaattcaagtcaccctcaatgatgaagccatcaaggatattcca
aaatcaattcatattaaaccagctgctgatccagagaaatcatacgctgaaggtccaggt
ttagatggtggtgaatgtttccaaccaagcaaattcaagattcatgcagttgatccagat
ggtgtacaccgtactgacggtggtgacggttttgtcgttaccattgaaggtccagctcca
gtcgatccagttatggtcgataatggtgatggtacatatgatgttgaatttgaaccaaaa
gaagccggtgactatgttatcaatctcactttagatggtgacaacgtcaatggtttccca
aagactgttaccgttaaaccagccccatccgctgaacactcttatgctgaaggtgaaggt
ttagtcaaagtatttgataatgccccagctgaattcactattttcgccgttgacactaaa
ggtgttgctcgtaccgatggtggtgatccatttgaagtcgctatcaatggtccagatggt
ttagtcgttgatgccaaagttaccgataacaatgacggtacttatggtgttgtctatgat
gccccagttgaaggtaactacaatgttaatgtcaccctccgtggtaatccaatcaaaaat
atgccaatcgatgtcaaatgcattgaaggtgccaatggtgaagattcatcattcggttca
ttcacttttaccgtcgctgctaaaaataagaaaggtgaagttaaaacctatggtggtgat
aaatttgaagtctctatcactggtccagctgaagaaatcactctcgatgctattgataac
caagatggtacttatactgccgcttactctttagttggtaatggtcgtttctcaactggt
gtcaaattaaacggtaaacacattgaaggttctccattcaaacaagtacttggtaaccca
ggtaaaaagaatccagaagttaaatctttcactactactcgtactgccaattaa

DBGET integrated database retrieval system