KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269444Help
Entry
DDB_G0269444      CDS       T00245                                 

Gene name
hemB
Definition
delta-aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DDB_G0269444 (hemB)
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DDB_G0269444 (hemB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0269444 (hemB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 333 aa AA seqDB search
MENNNKNYSHYLHSGYAHPITRSWQGDKVILKSQLIYPIFVTDLINTKTEIKSLPGQYQI
SSDLVVEFLRPLVEKGLKSIILFGVIISGVKDEQASSADKRESSPVIKSIELIKNEFPEI
LICTDLCLCAYTDHGHCGVLTEEGFIENEKSIIRLGEIALSFAKAGAHVIAPSDMMDCRV
GQIKKVLFQNGYGGRVAVMAYSSKFASSYYGPFRDAAGSGAKHGDRQAYQLPIASRGLGL
RAALRDEAEGADFIMVKPAGPYMDIIREVKDHVKVPVCCYQVSGEYAMIYHASVAGGIDL
KSGVMESLISLQRSGCDIFITYFTPQLLDWLKL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataataataaaaattattcccattatttacatagtggatatgcccatccaatt
actagatcatggcaaggtgataaggtcattttgaaatctcaattaatttatccaattttt
gttacagatttaattaatacaaaaactgaaattaaatccttaccaggacaatatcaaatt
tcaagtgatttagtagttgaatttttgagaccattggttgagaaaggattaaaatcaata
attttatttggtgtaattataagtggtgtaaaagatgaacaagcttcatctgccgataaa
agagaatcatcaccagttattaaatcaattgaattaattaaaaatgaatttccagaaatt
ttaatttgtacagatttatgtttatgtgcatatacagatcatggacattgtggtgtatta
acagaggaaggatttattgaaaatgaaaagagtattattagattaggagagatagcatta
tcatttgcaaaagcaggtgctcatgtaattgcaccaagtgatatgatggattgcagagtc
ggacaaattaaaaaggtattattccaaaatggatatggtggtcgtgttgcagtgatggcc
tatagctccaaatttgcatcatcctactatggtccatttagagatgcagctggaagtgga
gcaaaacatggcgatagacaagcttaccaattaccaattgcatcaagaggtttaggttta
agagctgcccttagagacgaagcagaaggtgccgatttcattatggttaaaccagctggt
ccttacatggatatcattcgtgaagtcaaagatcacgttaaagtaccagtatgctgttat
caggtcagtggtgaatatgctatgatttatcatgcatctgtcgctggtggtatcgattta
aaatctggtgttatggaatctttaatttccctccaacgttctggttgtgatattttcatt
acttatttcactccacaattattagattggttaaaattataa

DBGET integrated database retrieval system