KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269912Help
Entry
DDB_G0269912      CDS       T00245                                 

Gene name
redB
Definition
NADPH-cytochrome-P450 oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     DDB_G0269912 (redB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 667 aa AA seqDB search
MEILESIDFIEVLILDNLGAIIIVAVIVGTYLYMNKPPPPPPVFNKPNNKINKEAQKPKK
TITKNEDGKKVMKIFFGTQTRTAEDFSRIIEKECKKIGIPCEVVDLESYEHEQELHSESF
VMFLVATHGEGDPTDNAKEFYLWLTNDERPTDLLNGVPFTVFGLGNKTYEHYNAVARVID
RRMEELGGKRVFERGEGDDDATLEEDFNRWKKDMWPVVCKFLGYELKSTEDDKFVPRFRM
VTLNQDSKDINDPFIKIVSTPLKPKLSTDNKVIYDMKNPYYAEVLENRELHSNESDRSCR
HIEFKLGDEVSYTTGDHLGVFPINDSKLVEQLIKRLGVNGDDMIALVPIDQEGSVIKASF
GPMTIRRAFSEHLDITNPVRKSVLRALAESTTNEEEKKRLLYLATEEANEEYNKYIKNDF
RGVVDLLESFPGLQPLIAHFLEFTPRLPARMYSISSSPHNKNGVVSITSVVVNFTTGNQR
AHNGVASTWLSHLKVGDKVPLFVRESHFKLPSAATEQKPVIMVGPGTGLAPFRGFLQELQ
HRNHSQQQQSLLFFGCRSDTVDYIYREELEQYHQSSVLGDLVVAFSRKTSQKVYVQNKLL
EHKEKVWELLNKGAYFYVCGDGRNMSKAVQQALLSIIKEFGSKDDNSAQQFIDDMSSHGR
YLQDVWF
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttagaatcaattgattttattgaagttttaattttagataatttaggagcg
attattattgttgcagttatagtgggtacatacctttatatgaacaaaccaccaccacca
ccaccagtatttaataaaccaaacaataagatcaacaaagaagcacaaaaaccaaaaaag
acaatcacaaagaatgaagacggtaaaaaggtgatgaaaatattctttggtacacaaaca
cgtacagccgaagatttctcaagaatcattgaaaaagaatgtaaaaagattggtatccca
tgtgaagttgtagacttggaatcctatgaacacgaacaagaattacatagtgaaagtttt
gtaatgtttttagttgcaactcatggcgaaggtgatccaaccgataatgccaaagaattc
tacctttggttaacaaatgatgaacgtccaaccgatcttctcaatggtgtaccattcact
gtatttggtttaggtaataaaacttatgaacattacaatgccgttgcacgtgttatcgat
agaagaatggaagaattaggtggtaaaagagtctttgaaagaggtgaaggtgatgatgat
gcaactcttgaagaagatttcaatcgttggaaaaaagatatgtggcctgtagtttgtaaa
ttcttaggttatgaattaaaatcaactgaagatgataaattcgtaccaagatttagaatg
gtaactttaaatcaagatagtaaagatattaatgatcctttcattaaaatcgtttcaact
ccattaaaaccaaaattatcaactgataataaagtaatttatgatatgaaaaatccatat
tatgcagaggttttagaaaatagagaattacattcaaatgaatctgatagatcatgtaga
catattgaatttaaattgggtgatgaagttagttatacaacaggtgatcatttaggtgta
ttcccaattaatgatagtaaattggttgaacaattgataaagcgtttgggtgtcaatggt
gatgatatgattgcattggtaccaattgatcaagagggttcagttattaaagcaagcttt
ggtccaatgacaattagaagggcattctctgaacatttggatattacaaatccagtacgt
aaatcagtgttacgtgcattggcagagtcaaccactaacgaagaggaaaagaagagatta
ttatatttagcaaccgaagaagcaaacgaagaatacaataaatatattaaaaatgatttc
cgtggtgtcgtcgatcttttagaatctttcccaggtcttcaacctttgattgctcacttt
ttagaatttacaccacgtctaccagcccgtatgtactctatctcctcttcacctcacaat
aagaatggcgttgtttcaattacctctgtagtggttaatttcacaactggtaatcaaaga
gctcataatggtgtcgcctctacttggttatctcacttaaaagttggcgataaagttcca
ttatttgttagagaatctcactttaaattaccatctgccgccaccgaacaaaaacctgtc
attatggttggtcctggtactggtttagctcctttcagaggtttccttcaagaattacaa
catagaaatcattcacaacaacaacaatcactcttattctttggttgtcgttccgataca
gtcgactatatttacagagaagagttggaacaatatcatcaatcctcagttttaggtgat
ttggttgtagctttctcaagaaaaacttctcaaaaagtttatgtacaaaataaattattg
gagcataaagaaaaggtttgggagttattaaataaaggtgcctacttttacgtttgtggt
gatggtagaaatatgtccaaagctgtacaacaagccctcttatcaatcattaaagaattt
ggttcaaaagatgataactctgctcaacaattcattgacgatatgagttctcatggtaga
tatttacaagatgtttggttttaa

DBGET integrated database retrieval system