KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270190Help
Entry
DDB_G0270190      CDS       T00245                                 

Definition
cellulose-binding domain-containing protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
1
AA seq 572 aa AA seqDB search
MNNNYLKLFICLYLSFFLTIIVNGQQCWNKDNLSWRSGGDRKLTLNGVEITIQGIAWFGM
ETGTFSPGGLQSQSVESILDILVATGFNALRLPFSVDMLINKRYPNHINYSLNPNLQGKT
ALEVLQYITSESGKRGILIVLEQHRFDPADYISPLWYTTECFKNVDGVCINYTEQMVIDS
WINLTNLFKQYWNLWALDIKNEPHDPVTWGTGNPSTDWDKAFVRIVNQIDSSTNFNGVYF
IEGVQNNQGICSNMYNNWWGGNMSPVRCFPIYLNQPNRVVYAPHTYCSSVFDQEFFNAPD
YPNNMPTVWDAEFGFLADNVPTNQYAVLLGEWGCKVNTTKNSLFMDRFTQYLNDKNMKSH
LFFSLNPDSADTDSILYEDWKTVNQKTMNYLRKINSSPSKFTPNGNQICLGQVSTISTIG
SSTTTASQSTTTTTTGTGSTTSKPTTTGGSGSSTTTTKPSTTTTTTTTTTGGSSTTGSSN
VKAVIKQTIRQTWFDGTNTNTLVDCTLTNPSSSPIPIPRFAIDKTPSSSWELNLVSSNIV
SFTSWNNQISPGQTLSFGYIVSSSTVITFTQI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaataataattatttaaaattatttatttgtttatatttatcattttttttaacaatt
attgtaaatggtcaacaatgttggaataaagataatttaagttggagaagtggtggtgat
cgtaaattaacattgaatggtgtagaaattacaattcaaggtattgcatggtttggtatg
gaaactggtacattttcaccaggtggtttacaaagtcaaagtgttgaatcaattttagat
attttagttgcaactggtttcaatgcattacgtttaccattttcagttgatatgcttatt
aataaacgttatccaaatcatattaattatagtttaaatccaaatttacaaggtaagaca
gcacttgaagtattacaatatataacttctgaatctggtaaacgtggtattttgattgta
cttgaacaacatagatttgatccagctgattatatttcaccactttggtatacaactgaa
tgttttaaaaatgttgatggtgtatgtataaattatactgaacaaatggtaattgattct
tggattaatttaacaaatttatttaaacaatattggaatttatgggcattagatattaaa
aatgaaccacatgacccagttacatggggtactggtaatccttcaacagattgggataaa
gcatttgttagaattgtaaatcaaattgattcatcaacaaatttcaatggtgtttatttt
attgaaggtgttcaaaataatcaaggaatttgttcaaatatgtataataattggtggggt
ggtaatatgtcaccagtaagatgtttcccaatttatttgaatcaaccaaatcgtgttgtc
tacgctccacatacctattgttcaagtgttttcgatcaagaatttttcaatgctccagat
tatccaaataatatgccaaccgtttgggacgctgaatttggtttcttggctgataatgtt
ccaaccaatcaatatgcagttttattaggtgaatggggttgtaaagtaaacaccactaaa
aattcattatttatggatagattcactcaatatttaaatgataaaaatatgaaatcacat
cttttcttctctttaaatccagattctgctgatactgattcaattttatatgaagattgg
aaaactgttaatcaaaaaacaatgaattatttaagaaaaattaattcttcaccttcaaaa
ttcactccaaatggtaatcaaatttgtcttggtcaagtttcaacaatttcaacaattggt
agttcaactacaactgcttcacaatcaacaacaacaacaacaactggaacaggttcaaca
actagtaaaccaacaaccactggtggatcaggttcatcaacaactacaactaaaccatca
acaacaacaacaacaacaacaacaaccactggtggatcaagtacaactggatcatcaaat
gttaaagcagttattaaacaaactattagacaaacttggtttgatggtacaaatacaaat
actttggttgattgtacattaaccaatccatcaagtagtccaattcctattccaagattt
gcaattgataaaactccatcatcatcttgggaattgaatttagttagttcaaatattgtt
tcatttacaagttggaataaccaaattagtcctggtcaaactttatcatttggttatatt
gtttctagtagtactgtaattacatttactcaaatttaa

DBGET integrated database retrieval system