KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0271134Help
Entry
DDB_G0271134      CDS       T00245                                 

Gene name
celA
Definition
cellulase 270-6
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 705 aa AA seqDB search
MKILKNCILLIIFGLLSTQLINADTDYCSLLENALMFYKMNRAGRLPDNDIPWRGNSALN
DASPNSAKDANGDGNLSGGYFDAGDGVKFGLPMAYSMTMLGWSFIEYESNIAQCGLTSLY
LDTIKYGTDWLIAAHTADNEFAGQVGDGNVDHSWWGPPEDMTMARPTYMLTTEAPGTEIA
MEAASALAAASIAFKSSNPTYAATCLAHAKTLHNFGYTYRGVYSDSITNAQAFYNSWSGY
KDDLVWGSIWLYKATQDSDYLTKAVADYASGGVGGMAQGNSHDWDNKAPGCCLLLSKLVP
TTSTYKTDFEGWLNYWLPGGGVTYTPGGLAWIRQWGPARYAATAAFLGSLAGTEKGTDFT
QKQVDYLIGNNPNQQSFVVGMGPNYPINPHHRAAHHSTTNDINNPVNNLYLLKGALVGGP
GSNDEYTDDRTDYISNEVATDYNAGFVGALASLVNPSSTSVPTTTPTVTETPTETPTETP
TETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETV
TPTPTVTPTETPSSGESLSIYKSGLKNDFQDWSWGEHSLTDTTNVESGETNSISFTPKAY
GAVFLGCFECIDTDTYNNIEFDINGGSSGAQLLRITVVKNSKSVGSKLITDLNGGTPIEA
NSWTKIKASFIDDFKVSGKVDGIWIQDIKGDTQSTVYISNIIATA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgaaaaattgtatattattaataatatttgggttattatcaactcaatta
attaatgcggataccgattattgttcattacttgaaaatgcattaatgttttataaaatg
aatagagctggtcgtttaccagataacgatataccatggagaggtaattcagcattgaat
gatgcaagtccaaattcagctaaagatgccaatggtgatggtaatttaagtggtggttat
tttgatgctggtgatggtgttaaatttggtttaccaatggcttattctatgactatgttg
ggttggtcattcattgaatatgaatccaatattgctcaatgtggtttgacaagtttatac
ctcgatacaattaaatatggtaccgactggcttattgcagcacatactgccgataatgaa
tttgcaggccaagttggtgatggtaatgttgatcattcttggtggggtcctccagaagat
atgacaatggctcgtccaacttatatgttaacaaccgaagcaccaggtactgaaattgca
atggaagcagcatcagcattagctgcagcttcaatagcatttaaatcttcaaacccaaca
tacgctgcaacttgcttagcacatgctaaaactcttcataatttcgggtacacttatcgt
ggtgtttattcagattccattacgaatgctcaagctttttataattcatggtctggctat
aaggatgatttagtttggggtagcatttggttatataaagcaactcaagattcagattat
ttaacaaaagccgttgcagattatgcatcaggtggtgttggtggaatggcacaaggtaat
tctcacgattgggataataaagcaccaggttgttgtttattattatctaaattagttcca
accacaagtacttataaaactgatttcgaaggttggttaaattattggttaccaggtgga
ggtgtcacttatactccaggtggtttagcatggatcagacaatggggtccagctcgttat
gctgccactgccgctttccttggttctttagctggtactgaaaaaggcacagatttcact
caaaaacaagttgactatttaattggtaataatccaaatcaacaatcatttgtagttggt
atgggtccaaattatccaattaatccacatcatcgtgctgcccatcattctacaactaat
gatataaataatccagttaataatttatacctcttaaaaggtgctttagttggtggacca
ggttcaaatgatgaatatactgatgatagaactgattatatttcaaatgaagttgcaact
gattataatgctggtttcgttggtgcattagcttctcttgtaaatccatcttcaacttct
gttccaaccacaactccaacagtaactgaaaccccaacagagactccaactgagactcca
actgagactccaactgagactccaacagagactccaacagaaactccaacagagactcca
acagaaactccaacagagactccaacagaaactccaacagaaactccaacagaaactcca
acagaaactccaacagaaactccaacagaaactccaaccgagactccaactgaaactgtt
actccaaccccaacagtaacaccaactgaaactccatcaagtggagaatctttatcaatc
tataaaagtggattaaaaaatgatttccaagattggtcatggggtgagcattcattaact
gatacaacaaatgttgaatctggagaaaccaattcaatttcatttacaccaaaagcatat
ggtgcagtatttttaggatgtttcgaatgtattgatactgatacatacaataatattgaa
tttgatattaatggtggtagcagtggtgctcaattattaagaataactgttgttaaaaat
agtaaatctgttggttccaaattaattaccgatcttaatggtggaactccaatcgaagca
aattcatggactaaaattaaagcatcctttattgatgactttaaagtatctggtaaagtc
gatggtatttggattcaagatatcaaaggtgatacccaatcaactgtatacataagtaat
attattgcaactgcttaa

DBGET integrated database retrieval system