KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0271142Help
Entry
DDB_G0271142      CDS       T00245                                 

Gene name
proC
Definition
profilin III
Orthology
K05759  
profilin
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Exosome [BR:ddi04147]
 Exosomal proteins
  Proteins found in most exosomes
   DDB_G0271142 (proC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 126 aa AA seqDB search
MTWQAYIDTNLIGSGFISAQILSSADGSSWANSNGFSVSATEAQHILSCFKDSNKASAMG
ITINNVKNFVLKADDKSIYAKKDAGGVVLVKTNQTILVAVYNSNLQPGAAANACEALGDY
LREQGF
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacttggcaagcatatattgatactaatcttattggttcaggatttatttcagcacaa
attcttagttcagcagatggatcctcatgggcaaattcaaatggattttcagttagcgcc
actgaagcccaacatatcctttcttgttttaaagattcaaataaagcttcagcaatgggt
atcactatcaataatgttaaaaactttgtattaaaagctgacgataaatccatatacgca
aagaaagatgctggtggtgtagttttagtaaaaacaaatcaaaccattttagttgcagtt
tataatagtaatcttcaaccaggtgctgctgctaatgcttgtgaagcccttggtgattat
ttaagagaacaaggtttctaa

DBGET integrated database retrieval system