KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0271348Help
Entry
DDB_G0271348      CDS       T00245                                 

Definition
peptidase C19 family protein
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DDB_G0271348
Peptidases [BR:ddi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DDB_G0271348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 1037 aa AA seqDB search
MNYPHNTDNNDIILLLIDCISYKDISRQSIDRIKQFVENENDFKKLVNNLNIGLDYISQQ
QQPTATTIITNNGDFKSQLYSIMSDIFQTVYIKNKDIIEFNNFISICFTPSLLTSLLTPI
ISHNITSFLQIFKIILNCKIKHLNVFTVENINDIQYFYRSLKNIATRYPKIINRNSNILN
EELLTKPISMLLVKIIIDDLSTLPITMEPKQYDEIVYQYTKTIQLFWNSNQLSSIQVSME
HMFKKLMMSSSSSSSSSSNSSSSSSNNEIITPSISNVLNQSPIELIPLFINIIDNGSVSD
IDLLETITKLTQWPLTPTNSKWILETFNSLIRSKKTTLLASIVVESALSVIKQMFVLPLL
SSSFEILQKMLLGYQHSPDTFHSIIDLFPIVIELLLMFHNKINAIQHQPNGVDDGDGDDA
IKRIEFINQNTQQTVYKLINECNKNRKELLLISIKNTSQPSKYRNTILITLIKFCQLSYT
LMFHHTGYPELYAPLLESLNKCNHLLPSIPSEFQMKRLLQDNEWQSLDSMVFENIKLNRV
LTDRSGLINLGNTCYMNSFLQSLYMTIPFRNYLLFKIDQNLIKFINNNNNNNNNNTNNND
NNNDEEIFKIYSKEILKRPQLLKQIQLLFGNLRLSIKESISPNLFLQSLPIEFQTGQQHD
SFEFGKSLLDHLDLIFKQQIKNEQQQQQQQQQQQQLNLKNSNNASNSTNIVTEISNQFGG
KLSQITTCRKCSSESIKVEEFLELSLPFHDHRKQQYQLEEMINGYLSNEELIGDNRYHCS
KCNSLQDADKIIEINETPNHLIIGLNRFHFSRETKSIEKLLNHVDYPLNLNLPFIQNHQK
DRNNDEIKNENENEIKNENENENEKEDFKKIKINENDDDDDDDDGDENSKEKKKKSIIKL
SNYSLYSVIIHSGRSPTHGHYYNYSCTSSNNSNGKPVDWCLFNDSMVKITDVQTFKNINK
QFYTDVPYILFYVKNPSLPSSPIDNTIDTTNNDDVSPWIKQSIIKENQNLLSKFNNTKNK
NSNILEQFHTSGYFKKK
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccacacaatacagataataacgatattattttacttttaattgattgtata
agttataaagatatttcaagacaatctattgatagaattaaacaatttgtagagaatgaa
aatgattttaaaaaattagttaacaacttaaatattggtttagattatatatcacaacaa
caacaaccaacagcaacaacaataataacaaataatggggattttaaatcacaattatat
tcaataatgtctgatatatttcaaacagtttatataaaaaataaagatattattgaattc
aataactttatttcaatttgttttactccatcattattaacttcattattaactccaatt
attagtcataatataacatcatttttacaaatttttaaaattattttaaattgtaaaatt
aaacatttaaatgtattcactgttgaaaatataaatgatattcaatatttttatagatca
ttaaaaaatatagctacaagatatccaaaaattataaatagaaattcaaacattttaaat
gaagaattattaacaaaacctatatcaatgttattagtaaagataattattgatgattta
tcaacattaccaattacaatggaaccaaaacaatatgatgaaattgtatatcaatataca
aaaactattcaattattttggaatagtaatcaattaagttctattcaagtttcaatggaa
catatgtttaaaaaattaatgatgtcatcatcatcatcatcatcatcatcatcgaatagt
agtagtagcagcagtaataatgaaattataacaccaagtatttcaaacgttttaaatcaa
tcaccaattgaattaataccattgtttattaatattattgataatggatcagttagtgat
attgatttattggaaacaattacaaagttaactcaatggccattaacaccaaccaattct
aaatggatattagaaacatttaattcattaataagatcaaaaaaaacaacattattagca
tcaatagttgttgaatctgctctatcagtcattaaacaaatgtttgtacttccattatta
tcttcatcatttgaaatactacaaaagatgttactaggttatcaacattcaccagacact
tttcattcaatcattgatttatttccaattgttattgaattattattaatgtttcataat
aaaatcaatgctattcaacatcaacctaatggcgttgatgatggtgatggtgatgatgca
attaaaagaattgaatttattaatcaaaatacacaacaaacagtttataaattaattaat
gaatgtaataaaaatagaaaagagttattgttaatatcaataaagaatacatctcaacca
tctaaatatagaaataccattttgataacattgattaaattttgtcaattatcatataca
ttaatgtttcatcatactggttatcctgaactttatgcaccactattggaatcattaaat
aaatgtaaccatttattaccttcaattccatcagaatttcaaatgaaacgattacttcaa
gataacgaatggcaatcactagattcaatggtttttgaaaatataaaattaaatagagtt
ttaactgatcgttcaggtttaattaatcttggtaatacttgttatatgaattctttctta
caatcactttatatgacaataccatttagaaattatttattatttaaaattgatcaaaat
ttaattaaatttataaataataataataataataataataataataccaataataatgat
aataataatgatgaagaaatttttaaaatttattcaaaagaaattttaaaaagaccacaa
cttttaaaacaaattcaattattatttggtaatttaagattatctataaaagaatcgatt
tcaccaaacttattccttcaatcattaccaattgaatttcaaactggtcaacaacatgat
tcttttgaatttggtaaatcattattagatcatttagatttaatttttaaacaacaaata
aaaaatgaacaacaacagcagcagcagcagcaacagcaacaacaattaaatttaaaaaat
tcaaataatgctagcaattcaacaaatatagttacagagatatctaatcaatttggtggt
aaattatcacaaataacaacatgtagaaaatgtagtagtgaatcaattaaagttgaagag
tttttagaattatcattaccatttcatgatcatcgtaaacaacaatatcaattggaagag
atgatcaatggttacctttcaaatgaggaattaatcggtgataatagatatcattgttca
aagtgtaactctttacaagatgctgataaaataattgaaattaatgaaactcctaatcat
ttaatcattggtttaaatagatttcatttttcaagagaaactaaatcaattgaaaaactt
ttaaatcatgttgattatcctttaaatttaaatttaccttttattcaaaatcatcaaaaa
gatcgaaataatgatgaaattaaaaatgaaaatgaaaatgaaattaaaaatgaaaatgaa
aatgaaaatgaaaaagaagattttaaaaagattaaaattaatgaaaatgatgatgatgat
gatgatgatgatggtgatgaaaatagtaaagaaaaaaagaagaaatcaataataaaatta
tcaaattattcattatattcagtaatcattcatagtggtagatcaccaactcatggtcat
tattataattatagttgtactagtagtaataatagtaatggtaaaccagtggattggtgt
ctctttaatgattcaatggtaaagataactgatgttcaaacttttaaaaatattaacaaa
caattctataccgatgtgccctatattttattttatgttaaaaatccatcattaccatca
tcacctattgataatactattgatactactaataatgatgatgtatctccatggataaaa
caatcaattattaaagagaatcaaaatttattaagtaaatttaataatactaaaaataag
aattctaatattctggaacaatttcatacttctggatattttaaaaaaaaataa

DBGET integrated database retrieval system