KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272628Help
Entry
DDB_G0272628      CDS       T00245                                 

Definition
zinc-containing alcohol dehydrogenase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 340 aa AA seqDB search
MTKTTMKAAAFTQKNGKIEIIELPIPEPTQGWIRIKVHACGVCQGENVCKHGVMGNSFPR
VPGHEVVGEIDKLGEGVCNEEYKIGEFVGVGWFGGNQCGKCETCLENEWKHCKKVNTCGV
TYDGGYAEYMIAPISALVKIPKGMDPLEAAPLLCAGVTVYNSFRHQDIKVGSLVGVTGIG
GLGHYAIQFCKKMGYQVIAMSSGNSKEQLSKELGADYYVDMSKDNYIQEIQSIGSVKCIL
ATAPIASTVQGLLESLGINGKLVILAAFHEPFHADSLTMIGGSKSIVGWASGDNRDSLDT
LNFARNNNIKSLVNTFPLEKANEAFENIGQAKFRHVIKLL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaacaatgaaagcagcagcatttacacagaagaatggtaaaatagagatt
attgagttaccaatcccagaaccaactcaaggttggattagaattaaagttcacgcctgt
ggtgtttgtcaaggtgaaaatgtttgtaaacatggtgtaatgggtaattcatttccaaga
gttccaggacatgaggttgtaggtgaaattgataaattaggagaaggtgtttgtaatgaa
gaatataaaattggtgaatttgtaggtgttggttggtttggtggtaatcaatgtggtaaa
tgtgaaacatgtttagagaatgaatggaaacattgtaagaaagtaaacacttgtggtgtt
acttatgatggtggttatgcagagtatatgattgcaccaattagtgcacttgttaaaata
ccaaaaggaatggacccacttgaagctgcaccattgttatgtgcaggtgtaacagtttat
aattcatttagacatcaagacattaaagtaggttcattggttggtgttacaggtattggt
ggtttaggtcattatgcaattcaattctgtaagaaaatgggttaccaagtgattgcaatg
tcaagtggtaattcaaaagaacaactctcaaaagaattgggtgcagattattatgttgat
atgtcaaaggataattacattcaagagattcaatcaattggttcagttaaatgtatttta
gcaactgcaccaattgcatcaactgttcaaggtttattagagtctttaggtataaatggt
aaattggtgattttggctgctttccatgaaccattccatgcagattcattgacaatgatt
ggtggttctaaatcaatcgttggttgggcttctggtgataatcgtgattctcttgatact
ttaaattttgctcgtaataataatattaaatcattagtaaatactttcccattggaaaaa
gcaaatgaagcttttgaaaatattggtcaagcaaaatttagacatgttattaaattatta
taa

DBGET integrated database retrieval system