KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273017Help
Entry
DDB_G0273017      CDS       T00245                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DDB_G0273017
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DDB_G0273017
Enzymes [BR:ddi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DDB_G0273017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 468 aa AA seqDB search
MNSNEDECKFKFNVNQYIEEEAKKLQAEWDTNPRWKGIKREYTAEDVIRLRGSFKEEHTL
AKKGAEKLWDMLHEKDNWVPALGALSGNQAVQMVRGGLRAIYLSGWQVAADNNTSGQMYP
DQSLYAVNSVPELVRRINNALRRRDQIEVNEGNLEFQYLPTPIVADAEAGFGGPLNAYEL
MRSMIEAGASGVHWEDQLASEKKCGHMGGKVLIPTCGHIKNLTAARLASDVMGVPTLIVA
RTDSLGAGLLMSDVDARDKKFITGKRTVEGYYHLNCGIEQAIERALNYAPYCDLLWCETS
TPSIELAKQFADAVHEKFPGKLLAYNCSPSFHWKQHLKPDEIASFQRQLSDLGYKFQFIT
LAGFHALNLTMFELAKDYKKNAMTAYVNLQEKEFSLESEGYTATRHQREVGTGYFDQVSQ
IISGGQSSTLALVGSTEEEQFDEHIEKKKKVAHNNNGNNKNKAASVQN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaatgaagatgaatgtaaatttaaatttaatgttaaccaatatattgaagaa
gaagcaaagaaattacaagcagaatgggatacaaatccaagatggaagggaattaaaaga
gaatatactgcagaggatgtaattcgtttaagaggatcatttaaggaggagcatacatta
gcaaagaaaggtgcagagaaactttgggatatgttacatgaaaaagataattgggtacca
gcattgggtgcactttctggtaatcaagcagttcaaatggtacgtggtggtcttagagca
atctatttaagtggatggcaagttgctgccgataataatacctctggccaaatgtatcca
gatcaatcattgtatgccgtaaatagtgtacctgaattagttcgtagaattaataatgcc
cttagaagacgtgatcaaattgaagtcaatgaaggtaatcttgaattccaatatcttcca
acaccaattgttgcagatgcagaagcaggttttggtggcccattgaatgcctatgaactt
atgagaagtatgatcgaagctggtgcatcaggtgttcattgggaagatcaattggcaagc
gaaaagaagtgtggtcatatgggtggtaaagtactcattccaacatgtggtcatataaag
aatcttactgccgctcgtttagcatccgatgttatgggagtaccaacattgattgtagct
cgtaccgattctttgggagctggtttgttgatgagtgatgttgatgcacgtgataagaaa
ttcatcactggtaaacgtactgtcgagggttattatcacttgaattgtggtattgagcaa
gccattgaaagagcactcaattatgcaccctattgtgacttgttatggtgtgaaacttca
acaccatccattgaattagccaaacaattcgccgatgccgttcatgaaaaattcccaggt
aaacttttagcatacaattgttcaccatctttccattggaaacaacatttgaaaccagat
gaaatcgcctctttccaacgtcaactctctgatttgggctacaagttccaattcatcact
ttggctggtttccatgctctcaatttaacaatgtttgaattggcaaaggattacaaaaag
aatgctatgactgcctatgtaaatcttcaagagaaagaattctctttagaatctgaaggc
tatactgcaactagacatcaacgtgaagtaggtactggttactttgatcaagtttctcaa
attatctctggtggtcaatcttcaacattagctttagtaggttcaactgaagaagaacaa
tttgatgaacatattgaaaagaaaaagaaagttgctcataataataatggaaataataaa
aacaaagctgcaagtgttcaaaactaa

DBGET integrated database retrieval system