KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273105Help
Entry
DDB_G0273105      CDS       T00245                                 

Definition
cytochrome b5 domain-containing protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ddi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ddi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
Position
2
AA seq 786 aa AA seqDB search
MGKGSGAPLKEKVYPSVMYGNIKPIRKQPKSLPKELTIDQILQSLPKEVFETSNFKSACS
LLITILFIGLSATFITLMPSYLTPIGWMLMGASVTGLMVIGNDCIHKTFSKNPLVNSIIG
TIVMLPLLYPFQSYKISEKNNAEKKSTAVLNGEQFKINAHTTTESTNPIRQWATGKFFWI
LSIINWSENYFSTKNLSDKKDKTKAIVSIAIVYIFGFIFFPMMFKFVGVSGFLNYWFAPW
LVLHFLLSTASLLPSIPFYEELQVASKLEKSNNNNNNNKGDKKSSEVEKYLVHITYPQWF
EFIVKDINFSLPRQIAVSIPHYNLRKAYNSFKKSWGEYIYECTFETELFKELIIRSENFS
NEIFSPFDSAPLVPDQEKKAEATAEAVSNSRTSRTVKEFLKSINWLHVIILIGIPFIGLY
GLINVECSLKTFIWSFIYYHFTGMGITAGYHRLWAHKAYSAVLPVRIILLLFGAGAVEGS
CRWWSRDHRAHHRYLDTDKDPYSASLGFWHSHFIWLMFKQDPKKIGRANIDDLNADPWVM
WQHKHYIKIATFMGLVFPTLVAGLGWGDWAGGYFYSGVLRLVTVQHSTFLVNSLAHYLGD
SPYDDEHTPKDSVVTAILTFGEGYHNFHHEFPNDYRNAYKFYQYDPTKWLISAMYYLGLA
YDLKTFSKNEIEKGMIQMHQKHLDAKKQSIYWGINKEDLPSMTIDEFNNLVEKENKKLMI
INKTVLDVESFVNDHPGGLAYIKMGIGKDATSMFTGEVYAHSNAAKNLLCQFSIAKIVDN
HDKKQQ
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggaagtggagctcctttaaaggagaaagtttatccatctgttatgtatgga
aatattaaaccaattagaaaacaaccaaaatcattaccaaaagaattaactattgatcaa
attttacaatctcttccaaaagaagtttttgaaacaagtaattttaaatcagcatgttca
cttttaataacaatcttattcattggtttaagtgcaacattcattactctcatgccatct
tacttaaccccaattggttggatgttaatgggtgcctcagttactggtttaatggtaatt
ggtaatgattgtattcataaaactttttcaaagaatccattagttaattcaattattgga
acaattgtaatgttaccattgttatatccattccaatcttacaagatttcagaaaagaat
aatgcagaaaagaaatcgacagctgttttaaatggtgaacaattcaagattaatgcacat
accacaaccgaaagtacaaatccaattagacaatgggcaactggtaaattcttttggatt
ttatcaattattaattggtctgaaaattatttctcaactaaaaatttatcagataaaaaa
gataaaaccaaagcaatcgtttcaattgcaattgtttacatttttggatttattttcttc
ccaatgatgtttaaatttgtaggtgtaagtggattccttaattattggttcgcaccatgg
ttagttttacatttcttactttcaactgcttcattattaccatcaattccattttatgaa
gaattacaagttgcttcaaaattagaaaaatcaaataataataataacaataacaaaggt
gataagaaatcatctgaagttgaaaaatatttagtacatattacatatccacaatggttt
gaatttattgttaaagatattaatttttcattaccaagacaaattgcagtttcaattcca
cattataatctaagaaaagcttataattcatttaaaaagagttggggtgaatatatttat
gaatgtacatttgaaactgaattatttaaagaattaattatccgtagtgaaaacttttca
aatgaaattttctcaccatttgattcagctccattggtaccagatcaagaaaagaaagca
gaagcaaccgctgaagccgtttcaaatagtcgtacaagtcgtactgttaaagaattttta
aaatcaatcaattggttacatgttatcattttaattggtattccattcattggtctctat
ggtctaattaatgtagagtgttcattgaaaacatttatttggtcatttatttattatcat
ttcactggtatgggtattacagcaggttatcatagactttgggctcataaggcttatagt
gcagttttaccagttcgtattatcttgttgctatttggtgcaggtgctgtcgaaggttca
tgtcgttggtggtcaagagatcatcgtgctcatcatcgttatctcgatactgataaagat
ccatattcagcttcattgggtttctggcattcccatttcatttggttaatgttcaaacaa
gatccaaagaaaatcggtagagcaaacattgacgaccttaacgccgatccatgggttatg
tggcaacataaacattacattaaaatcgccacttttatgggtctcgttttcccaacattg
gtagctggtttaggttggggtgattgggctggtggttatttctactctggtgtacttcgt
ctcgttacagttcaacattccacattcttggtcaattcattggctcattatttaggtgac
tctccatacgatgatgaacatactccaaaggattcagttgtgactgctatattaacattt
ggtgaaggttatcataacttccatcatgaattcccaaatgactatagaaacgcttataaa
ttctatcaatatgatccaactaaatggttgatctctgcaatgtattatttaggcttggct
tatgatttgaaaactttctccaaaaatgaaattgaaaaaggtatgattcaaatgcaccaa
aaacatttagacgcaaagaaacaatcaatctattggggtatcaataaagaagatttacca
tcaatgacaatcgatgaatttaataatttggttgaaaaagaaaataaaaagttaatgata
atcaacaaaaccgtattagatgtcgaatcttttgttaatgatcacccaggtggtttagct
tacattaaaatgggtattggtaaagatgcaacttcaatgtttactggtgaagtttatgct
cattcaaatgctgctaaaaatttattatgtcaattttcaattgctaaaattgttgataat
catgataaaaaacaacaataa

DBGET integrated database retrieval system