KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273291Help
Entry
DDB_G0273291      CDS       T00245                                 

Gene name
ddo-2
Definition
D-amino-acid:oxygen oxidoreductase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ddi00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ddi00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:ddi00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ddi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
Position
2
AA seq 346 aa AA seqDB search
MNQNKNNNNKNPKINLLIIGCGCIGLSTGIIALKSGNYKSVSIWAKDLPPNTTSNKAAAL
WYPFLCNPLDLVGKWSAETMQYYKDHIINDPKSGTITKKVNEIFRRPHPEDPEWKPYIKS
FRRARKDELPDGYVDGYAIDDGFVMDTDMYMDYLVDQFKSLGGIIEQRHLVDIREAFVDH
DVVVNCTGLGSRELFNDRTIYPGRGQIIVIKNSTDRSIMDEEDHIAYVIPRLTNTVLGGT
NQEHDYNTNPTKKDTEEILKRVAMISPRFAKNRIEIQGVKVGLRPARHEIRLENEFFEGG
SKLVVHNYGHGGSGFTVSWGCAIEAIKLVDQGLPKLLHFNKLISKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaataaaaataataataataaaaatccaaaaattaatttattaattattgga
tgtggttgtattggtttatcaacaggtattattgcattaaagagtggtaattataagagt
gtatcaatttgggccaaagatttaccaccaaatacaacctcaaataaagcagcagcatta
tggtatccatttttatgtaatccactagatttagttggtaaatggtcagcagaaaccatg
caatattataaagatcatattattaatgacccaaaatcaggtacaatcacaaagaaagta
aatgaaattttcagacgtccacatccagaagatccagaatggaaaccatacattaaatca
tttagaagagctagaaaagatgaactaccagatggatatgtagatggttatgcaattgat
gacggtttcgttatggacactgatatgtatatggattatttagtcgaccaattcaaaagt
ttaggtggaatcattgaacaaagacacctcgttgatattcgtgaagcttttgttgaccat
gatgtagttgtaaattgcaccggtttaggatcacgtgaattattcaatgatcgtacaatt
tatccaggtcgtggtcaaattatcgttattaaaaactcaaccgatcgttcaatcatggat
gaagaagatcatatcgcatatgtaattccacgtttaacaaatacagttttaggtggtaca
aatcaagaacacgattacaatacaaatccaactaaaaaagatactgaagaaatcttaaaa
cgtgtagccatgatttcaccacgttttgctaaaaatagaattgaaattcaaggtgttaaa
gttggtctacgtcctgctagacatgaaattcgtttagaaaatgaattctttgaaggtggt
tcaaaattagtagttcataactatggtcatggtggtagtggtttcactgtaagttggggt
tgtgctattgaagcaattaaattagttgatcaaggtttaccaaaattattacattttaat
aaattaataagtaaattataa

DBGET integrated database retrieval system