KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273783Help
Entry
DDB_G0273783      CDS       T00245                                 

Gene name
ddo-1
Definition
D-amino-acid:oxygen oxidoreductase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDB_G0273783 (ddo-1)
   00330 Arginine and proline metabolism
    DDB_G0273783 (ddo-1)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    DDB_G0273783 (ddo-1)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DDB_G0273783 (ddo-1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DDB_G0273783 (ddo-1)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     DDB_G0273783 (ddo-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 346 aa AA seqDB search
MNQNKNNNNKNPKINLLIIGCGCIGLSTGIIALKSGNYKSVSIWAKDLPPNTTSNKAAAL
WYPFLCNPLDLVGKWSAETMQYYKDHIINDPKSGTITKKVNEIFRRPHPEDPEWKPYIKS
FRRARKDELPDGYVDGYAIDDGFVMDTDMYMDYLVDQFKSLGGIIEQRHLVDIREAFVDH
DVVVNCTGLGSRELFNDRTIYPGRGQIIVIKNSTDRSIMDEEDHIAYVIPRLTNTVLGGT
NQEHDYNTNPTKKDTEEILKRVAMISPRFAKNRIEIQGVKVGLRPARHEIRLENEFFEGG
SKLVVHNYGHGGSGFTVSWGCAIEAIKLVDQGLPKLLHFNKLISKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaataaaaataataataataaaaatccaaaaattaatttattaattattgga
tgtggttgtattggtttatcaacaggtattattgcattaaagagtggtaattataagagt
gtatcaatttgggccaaagatttaccaccaaatacaacctcaaataaagcagcagcatta
tggtatccatttttatgtaatccactagatttagttggtaaatggtcagcagaaaccatg
caatattataaagatcatattattaatgacccaaaatcaggtacaatcacaaagaaagta
aatgaaattttcagacgtccacatccagaagatccagaatggaaaccatacattaaatca
tttagaagagctagaaaagatgaactaccagatggatatgtagatggttatgcaattgat
gacggtttcgttatggacactgatatgtatatggattatttagtcgaccaattcaaaagt
ttaggtggaatcattgaacaaagacacctcgttgatattcgtgaagcttttgttgaccat
gatgtagttgtaaattgcaccggtttaggatcacgtgaattattcaatgatcgtacaatt
tatccaggtcgtggtcaaattatcgttattaaaaactcaaccgatcgttcaatcatggat
gaagaagatcatatcgcatatgtaattccacgtttaacaaatacagttttaggtggtaca
aatcaagaacacgattacaatacaaatccaactaaaaaagatactgaagaaatcttaaaa
cgtgtagccatgatttcaccacgttttgctaaaaatagaattgaaattcaaggtgttaaa
gttggtctacgtcctgctagacatgaaattcgtttagaaaatgaattctttgaaggtggt
tcaaaattagtagttcataactatggtcatggtggtagtggtttcactgtaagttggggt
tgtgctattgaagcaattaaattagttgatcaaggtttaccaaaattattacattttaat
aaattaataagtaaattataa

DBGET integrated database retrieval system