KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274111Help
Entry
DDB_G0274111      CDS       T00245                                 

Gene name
pfkA
Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00030  Pentose phosphate pathway
ddi00051  Fructose and mannose metabolism
ddi00052  Galactose metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
ddi01230  Biosynthesis of amino acids
ddi03018  RNA degradation
Module
ddi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0274111 (pfkA)
   00030 Pentose phosphate pathway
    DDB_G0274111 (pfkA)
   00051 Fructose and mannose metabolism
    DDB_G0274111 (pfkA)
   00052 Galactose metabolism
    DDB_G0274111 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DDB_G0274111 (pfkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DDB_G0274111 (pfkA)
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DDB_G0274111 (pfkA)
Messenger RNA biogenesis [BR:ddi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DDB_G0274111 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK TMEM214
Motif
Other DBs
NCBI-GeneID: 8619591
NCBI-ProteinID: XP_644162
dictyBase: DDB_G0274111
UniProt: P90521
Position
2
AA seq 834 aa AA seqDB search
MTTTSKIINDGEGEDVKGNKNINKKSLIDENRLDEKKDLLSDKVESKTHCSVKRMAVLTS
GGDSSGMNPAIRAFARQVMLKGAKVFAVREGYNGLVNDSIVPLNWGSVAGIISRGGTIIG
TARSAEFRTREGRKRAVFNLVKNRIDNLLVIGGDGSLTGANLLRTEWCSLLEELVKDGKL
TLDVMEHFPILSIAGIVGSIDNDMCGTDLTVGADTATKRILEAIDSILSTAVSHQRSFVI
EVMGRNCGWLALASGVATGADYILIPESPPDDGWEQTMADNLERGRLSGRRCSLVIVSEG
AIDRQGKPITSAYVRQFLEDKGHDARITILGHVQRGGTPTFLDRYIATRMGIEAANYFYD
STIEQLKQPVLIGMSGMDTIRSPLMECVQKTQSIASLIKERRFNEVVDVRGGMFKEFYEI
FIACSNLHRRKVESKGMGVLILHSGGPSPGMNPCVRAFTRLGIDHGYTMYGCFNGFGGLA
LGEIEQLHWMTVNGWSVMGGAELGTNRSIPNDSNIEAIIATLERFKINAILMFGGFNGYL
GIAKLYEYREKYQQLKRISIIGAPGTIANNVPGTNISIGSDTSLNNTLDALDKIKQSAVA
SRRLFVVEVMGAHCGYLAAMSSLTSGAERSYIMERGITLNTLTKDLEMFVERFKREHRIG
LIIKSELASNTYSTHFIYSLFKEEGKHLFDVRESILGHLQQGGTPSAIDRIFSTRLMNHY
YQFLENDLKEHGHLQMNGCIGFIDGGIHYTPMQEMIEEMSDKFRRPRSQWWMDLVETSQN
ISVFPLDDPSSTNFEGCNSNLSEQDRPIKKSDISSPTSYSQKTFDPNVNPQFTL
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgtcaaaaatcattaatgatggtgaaggtgaagatgttaaaggtaataaa
aatataaataaaaaaagtttaattgatgaaaatagattagatgaaaaaaaagatttatta
agtgataaagttgagagtaaaacccattgttcagtaaagagaatggcagtattaacatca
ggaggtgatagcagtggtatgaatccagcaattagagcatttgcaagacaagtaatgtta
aaaggagcaaaagtatttgcagttagggaaggttataatggtttggttaacgattcaatt
gtacctttgaattggggatcagtagcaggtattatctcccgtggtggtacaatcattggt
acagcaagaagtgctgaatttcgtacacgtgagggtagaaagagagccgtattcaatttg
gtgaagaatagaatcgacaatctattggttataggtggtgatggctcattgacaggcgca
aatttattgagaactgaatggtgttcattgcttgaggagttggtcaaagatggcaagttg
acattggacgttatggagcatttcccaattttatcaatcgctggtatagtaggatcgatc
gataatgatatgtgtggcacagatttaacggttggtgctgatacagcaaccaagagaatt
ttagaggcaatcgattcaattctatcgacagcagtttcacatcaacgtagttttgtcatt
gaagttatgggaagaaattgtggttggttggcattggcatcgggtgttgcaacaggtgca
gattatatattgatacctgaatcaccaccagatgatggttgggagcaaactatggctgat
aatcttgaaaggggtagattgtcaggaagaagatgcagtttggtcattgtgtcagaaggt
gcaatcgatcgtcaaggcaaaccaatcacttcagcctatgttagacaattccttgaggat
aaaggccacgatgcaagaatcaccattcttggtcatgtacaacgtggtggtacaccaaca
tttttagatcgttacattgcaactcgtatgggtatagaagcagcaaactatttctatgat
tcaaccattgaacaattgaaacaacctgtattgatcggtatgagtggtatggataccatt
cgttcaccattgatggaatgtgtacaaaagactcaatcaattgcatcactcatcaaggag
agacgtttcaatgaggttgtcgatgttagaggtggtatgtttaaagagttttatgagatc
ttcattgcatgttcaaatttacatcgtagaaaggttgagagcaagggaatgggtgtttta
atacttcatagtggtggtccatcaccaggtatgaacccatgtgttcgtgctttcactcgt
ttaggtattgatcatggttacacaatgtatggttgcttcaatggatttggtggtttagca
ttgggtgaaattgaacaattacattggatgactgtaaatggttggtctgttatgggtggt
gcagaattgggtaccaatcgttccattccaaatgatagtaacatagaggctatcattgca
actcttgaacgttttaaaatcaatgcaattctaatgtttggtggattcaatggttatttg
ggcatagcaaaactctacgaatatagagagaaatatcaacaacttaaacgtatctcaatc
attggtgcacctggtaccattgcaaacaacgtaccaggtacaaatatctcaattggaagt
gatacctctttgaataacacattggatgcattagataaaatcaaacaatcagcagtggca
tcacgtcgtttattcgtcgtggaggtcatgggtgcccattgtggttatttggctgcaatg
agttctttaacctcaggtgctgaacgttcatatataatggaaagaggtatcacattgaat
acactaaccaaggatttggaaatgtttgttgaacgtttcaaacgtgaacatagaattggt
ctaattattaagagtgaacttgctagcaacacctactcaactcatttcatttattcactc
ttcaaagaagaaggtaaacatttattcgatgtccgtgaatctatactcggtcatttacaa
caaggtggtactccttctgcaattgatcgtatcttttcaactcgtttaatgaatcattat
tatcaattcttggaaaacgatctcaaagaacatggtcatcttcaaatgaatggttgtatt
ggtttcattgatggtggtattcattacactccaatgcaagaaatgatcgaagaaatgtct
gataaatttagacgtcctcgttcccaatggtggatggatttggttgaaacctctcaaaat
atctctgttttccctttagatgacccttcctctactaatttcgaaggttgtaattcaaat
ttatcggaacaagatagacctattaaaaaatctgatatttcttctccaacctcttattct
caaaaaacttttgacccaaatgttaatccacaatttactctataa

DBGET integrated database retrieval system