KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274567Help
Entry
DDB_G0274567      CDS       T00245                                 

Gene name
mtrpS
Definition
(RefSeq) tryptophan-tRNA ligase
  KO
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    DDB_G0274567 (mtrpS)
Enzymes [BR:ddi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     DDB_G0274567 (mtrpS)
Amino acid related enzymes [BR:ddi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DDB_G0274567 (mtrpS)
Transfer RNA biogenesis [BR:ddi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DDB_G0274567 (mtrpS)
 Prokaryotic Type
    DDB_G0274567 (mtrpS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
dictyBase: 
UniProt: 
Position
2
AA seq 377 aa AA seqDB search
MKIDEVNFKDKTKVTVFSGMQPTSSALHLGNYLGAMGNWLKIQDLVTKNNKEEEELLNLS
ESSSSSSSSQSTKINEKHKLIFSIVDLHSLTSTKSLSPKELQSNTISVAINYLACGIDPE
KVILFNQSMVPAHSELTWILNCITSFSKLSNMIQFKEKTKSSNEASVSNGLLSYPVLMAA
DILLYKATHVPVGEDQTQHLEFTRDIAQAFHSNFKSKFFPYPSIITSEQSKRIMSLQDGR
LKMSKSDPLEISRISLTDTDDQIKLKIKKSKTDTIIGITYDPINRPDISNLLSIASETSG
IPITDLQSEFKDKSNAIFKEFLSNSIIKNISPIREKINYYQSNPKLVRDILLQGSEKANK
IANKNLNIIKDIVGLYH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgatgaagttaattttaaagataaaactaaagttacagtatttagtggtatg
caaccaacaagttcagcattacatttaggtaattatttaggtgcaatgggtaattggtta
aaaattcaagatttagttacaaaaaataataaagaagaagaggaattattaaatttatca
gaatcatcatcatcatcatcatcatcacaatctacaaaaataaatgaaaaacataaatta
atattttcaattgttgatttacattcattaacatcaactaaatcattatcaccaaaagaa
ttacaatcaaatactatttcagttgcaataaattatttagcatgtggaattgatccagaa
aaggtgattttatttaatcaatcaatggtaccagcacattcagagttaacttggatttta
aattgtattacctcattttcaaagctaagtaatatgattcaatttaaagagaaaactaaa
tcatcaaacgaagcatcagtttcaaatggacttttatcatatccagttttaatggctgcc
gatattttattgtataaagccacacatgtaccagtaggcgaggaccaaactcagcattta
gaattcaccagagatatcgcacaagcatttcacagtaatttcaagagtaaattctttcca
tatccctcaattataacttctgagcaatctaaaagaattatgagtttacaagatggtcgt
ttgaaaatgagtaaatctgatccattagagatttcaagaatttcattaacagatactgat
gatcaaattaaattaaaaattaaaaaatcaaaaactgatacaatcattggtataacctat
gatccaattaatcgtcctgatatttcaaatctattatcaattgcatctgaaacctctggt
ataccaatcactgatttacaatctgaatttaaagataaatcaaacgcaatctttaaagaa
tttctttcaaattcaatcattaaaaatatatcaccaattcgtgaaaaaattaattattat
caatcaaatccgaaattagttagagatattttattacaaggatctgaaaaagcaaataaa
attgcaaataaaaatttaaatataattaaagatatagttggtttatatcattaa

DBGET integrated database retrieval system