KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274827Help
Entry
DDB_G0274827      CDS       T00245                                 

Definition
peptidase C19 family protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DDB_G0274827
Peptidases [BR:ddi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DDB_G0274827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 919 aa AA seqDB search
MPIITSSNVTTSTLENGNILKKINKTPIKKKMATTTNSDTISPIEKLKQKNKLIKSQQLQ
QQQSTQQTIGETMQNILYKKQNLIENKDKDDDENEQDNNNNEQDNKLKKKQDKIKNKEEI
EKLNIKKKQVNSAISNEAKPLFHRMIKFKEAEIQDDSNDQLKNKYKPINKLNDSASKKLA
DLAKAKSEAKKKEKEGGEEEEDDDNILAKPKKVLFSVDQLSKLMEWKSVQRIGSGLNNVG
NTCFMNSVLQCLTYTVPLANFMMSREHSRQCQASGFCIFCSLETQVLQSHKCGGKSITPK
EIASNIRKIAPTFRIGRQEDSHEFIRFMIESLQKVSLSKYPKGSINHRDAMTTVIGSIFG
GYLRSQVKCSQCQYESNTYDPFMDLCVDINQADSLTKGLTNFVKSELLDGSNKYKCSKCK
KLVKAQKRLQIHIAPPILTCQIKRFSFLGSYGGKINRQIQFDQSLNLSPFMTQSNNHSIY
DLYAVLVHLGGSTSSGHYYCYVKGSNGIWYNMDDSSVSQVSLNTVLSQKAYMLFYSKRNI
DQSINTNTVSINTIGNKRKLDDEKLTSKITTPTTTTTTITTTPEITADEKQNIKKQKITN
ITTTTTTTTTTTTTKPINNNNTVTSSPKIESTKKVSPQIKSTSLSQSQSPSPSPKMKSIS
LGNDEIIDKQTLKNQTSDDDEEDDDSYSDSDESSLSGPSSESDNGGISPSLISTNLSPKL
TTPSTIINIHNQSKKDKKDAEKLEKQKQENENKTTTTKQQQEEGLDWEKIRVPQQSTTDD
KRKLKSINNSKQNLENSKINPENGHLPFKVGSWDIEDIGSDFKQARKELLGDELLKEIKH
EKDEHNKHFDLGRVKKVKTKKHLSQDEPNQFNKLAAQLKQRKENELKYGNDRSSKFTNKS
INKQQQSTTNKNRPKKFTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcattacaagttcaaatgttactacatccacattggaaaatggtaatatttta
aaaaaaattaataaaaccccaattaaaaagaaaatggcaacaacaacaaacagtgataca
atatcaccaattgaaaaattaaaacaaaaaaataaattaataaagagtcaacaactacaa
caacaacaatcaactcaacaaacaattggagaaactatgcaaaatattctatataaaaaa
caaaatttaatagaaaataaagataaagatgatgatgaaaatgaacaagataataataat
aatgaacaagataataaattaaaaaaaaaacaagataaaattaaaaataaagaagagatt
gaaaaacttaatattaaaaagaaacaagttaattcagccatttcaaacgaagcaaaacca
ttatttcatagaatgattaaatttaaagaagcagagattcaagatgattcaaatgatcaa
ttgaaaaataagtataaaccaattaataaattaaatgatagtgcatcaaagaaattagca
gatttggcaaaagcaaagagtgaagctaaaaagaaagagaaagagggaggcgaggaagag
gaagatgatgataatattttagcaaaacctaaaaaagttttatttagtgttgaccaattg
tccaagctcatggaatggaaatcagttcaacgtattggtagtggtttaaataatgttggt
aatacatgtttcatgaattcagtattacaatgcttgacatacactgtgccattggccaat
ttcatgatgtcacgtgaacactcaagacagtgtcaggctagtgggttttgtatattttgt
agtttagaaactcaggttctacaaagccataaatgtggtggtaagagtatcacaccaaag
gagattgcttcaaatattaggaaaatagcaccaacatttagaattggtcgtcaagaagat
tctcatgaatttattagattcatgattgagtcattgcaaaaggttagtttatcaaagtat
ccaaaaggctcaataaatcatcgtgatgcaatgaccactgttattggtagtattttcggt
ggttatttacgatcacaagttaaatgttcacaatgtcaatatgaatcaaatacatatgat
ccattcatggatttatgtgttgatattaatcaagcagattctctaactaaaggtttaaca
aatttcgttaaatctgaactattggatggttcaaataaatataaatgttcaaaatgtaaa
aaattagttaaagctcaaaaacgtttacaaattcatatagctcctccaattttaacttgt
caaattaaacgttttagtttcttaggttcttatggtggtaaaattaatagacaaattcaa
tttgatcaaagtttaaatctttcaccatttatgactcaatcaaataatcattcaatttat
gatttatatgcagtattagtacatttaggtggtagtacatcatcaggtcattattattgt
tatgttaaaggttcaaatggtatttggtataatatggatgattcatcagtatcacaagtt
agtttaaatacagttttatcacaaaaagcatatatgttattttattcaaaaagaaatatt
gatcaatcaattaatacaaatacagtttcaataaatactattggtaataaaagaaaatta
gatgatgaaaaattaacttcaaaaataacaacaccaacaacaacaacaacaacaataaca
acaacaccagaaataacagctgatgaaaaacaaaatataaagaaacaaaaaattactaat
ataactactacaactactacaacaacaacaacaacaacaacaaaaccaattaataataat
aatacagtcacttcttcaccaaagattgagtcaacaaaaaaagtatcaccacaaataaaa
tcaacatcattatcacaatcacaatcaccatcaccatcaccaaagatgaaatcaatttca
cttggaaatgatgaaataatagataaacaaactttaaagaatcaaactagtgatgatgat
gaagaagatgatgatagttattcagattctgatgaatcatcattatcaggtccatcatca
gaatctgataatggtggaatttcaccatctttaatatcaactaatttatcaccaaaatta
actacaccttcaacaattattaatattcataatcaatctaaaaaggataaaaaggatgct
gaaaaattagaaaaacaaaaacaagaaaatgaaaataaaacaacaacaactaaacaacaa
caagaagaaggattagattgggaaaaaattagagtaccacaacaatcaacaactgatgat
aaaaggaaattaaaatcaattaataattcaaaacaaaatttagaaaattcaaaaattaat
ccagaaaatggccatttaccatttaaagttgggtcttgggatattgaagatattggtagt
gattttaaacaagctagaaaggaattattaggtgatgagttattaaaagaaattaaacat
gaaaaggatgaacataataaacattttgatcttggtagagttaaaaaagttaaaactaaa
aaacatttatctcaagatgaaccaaatcaattcaataaattggctgcacaattaaaacaa
cgtaaagaaaatgaattaaaatatggcaatgatagatcttcaaaattcacaaataaatca
ataaataaacaacaacaatccactactaataaaaatagaccaaagaaattcactggttaa

DBGET integrated database retrieval system