KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274887Help
Entry
DDB_G0274887      CDS       T00245                                 

Definition
hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
2
AA seq 347 aa AA seqDB search
MNKNFKFIILIFLIVSILFINLNNCQDNDNEEVDMNDNSNSDVIILTDSNFEDLTTSNPN
ETWMVEFYAPWCFHCKNLKKTYDQLSTKLKQQDPNLKVAKIDCVANPKQCKRFSIRSYPT
IKVIKGNSVYDMKGEKTLNSLNEFINKGYEKSVDQIKQLPASIILKVVDLTDKTFPSVND
GSWLIYFHIPRCIYCEKFMSEFDALPSADFSKSNEKFNFGKINCQTYKEICDLYRVEYFP
NVKFFENSTNLYYNFNHEPTTSNLKEFAMFYYKHVSPIKRPWNAMFSLFEEAIREFVWLF
LLVSFLFGFFICYIFYGMVPPSPPPPPPPPSTIQSKNQIQTKMKKSE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaattttaaatttattattttaatatttttaatagtatcaattttatttata
aatttaaataattgtcaagataatgataatgaagaggttgatatgaatgataatagtaat
agtgatgttataatacttacagattcaaattttgaagatttgacaacatcaaatccaaat
gaaacttggatggtagaattttatgcaccttggtgttttcattgtaaaaacttaaagaaa
acatatgaccaattatctacaaaattaaaacaacaagacccaaatcttaaagttgcaaaa
atagattgtgttgcaaatccaaaacaatgtaaaagattctcaattagatcatatccaaca
attaaagttataaaaggaaattcagtttatgatatgaaaggtgagaaaacattaaatagt
ttaaatgaatttataaataaaggttatgaaaagagtgttgatcaaattaaacaattacca
gcatcaattattcttaaagttgtcgatcttacagataaaacattcccatcagtaaatgat
gggtcatggttaatttattttcatattccaagatgtatttattgtgaaaaatttatgtca
gaatttgatgcattgccatcagcagatttctcaaaatcaaatgaaaaatttaattttgga
aaaattaattgtcaaacttataaagaaatatgtgatttatatagagtagaatatttccca
aacgttaaatttttcgaaaattcaacaaatttatattataatttcaatcacgaacctact
acatctaatttaaaagagtttgcaatgttttattataaacatgtttcccctataaagaga
ccatggaatgcaatgttttctttatttgaagaggcaattagagagtttgtttggctattc
ttattggtatcgtttttatttggtttctttatttgttatattttttatggaatggtacca
ccatcaccaccaccaccaccaccaccaccatcaacaattcaatctaaaaatcaaattcaa
actaaaatgaaaaagtctgagtaa

DBGET integrated database retrieval system